KEGG   Rattus norvegicus (rat): 58835
Entry
58835             CDS       T01003                                 

Gene name
Phgdh
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno00270  Cysteine and methionine metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01230  Biosynthesis of amino acids
Module
rno_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    58835 (Phgdh)
   00270 Cysteine and methionine metabolism
    58835 (Phgdh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    58835 (Phgdh)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     58835 (Phgdh)
    1.1.1.399  2-oxoglutarate reductase
     58835 (Phgdh)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   58835 (Phgdh)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh PGDH_inter
Other DBs
NCBI-GeneID: 58835
NCBI-ProteinID: NP_113808
RGD: 61987
Ensembl: ENSRNOG00000019328
UniProt: O08651
Position
2
AA seq 533 aa
MAFANLRKILISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVT
ADVINAAEKLQVVGRAGTGVDNVDLEAATRKGVLVMNTPNGNSLSAAELTCGMLMCLARQ
IPQATASMKDGKWDRKKFMGTELNGKTLGILGLGRIGREVAARMQAFGMKTVGYDPIISP
EVAASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIV
DEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIA
VQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMHAWAGSPKGTIQVVTQG
TSLKNAGTCLSPAVIVGLLREASKQADVNLVNAKLLVKEAGLNVTTSHSPGVPGEQGIGE
CLLTVALAGAPYQAVGLVQGTTPMLQMLNGAVFRPEVPLRRGQPLLLFRAQPSDPVMLPT
MIGLLAEAGVQLLSYQTSKVSDGDTWHVMGLSSLLPSLDAWKQHVSEAFQFCF
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggccttcgcaaatctgcgcaaaatactcatcagtgatagcctcgacccctgctgccgg
aagatcctgcaagatggagggctgcaggtggtggagaagcagaacttgagcaaggaggag
ctgatagccgaactccaggactgtgaaggccttatcgtccggtcagctactaaggtcact
gctgatgtcatcaatgcagcagagaagctccaggtggtgggcagggctggtacaggcgtg
gacaatgtggatctggaggctgccacaaggaagggcgtcctcgtcatgaacacccccaat
ggaaatagcctcagtgctgcggaactcacctgtgggatgctcatgtgcctggccaggcag
atcccccaggcgacggcttcgatgaaagatggcaaatgggaccggaagaagttcatgggg
acagagctgaacgggaagacactgggaattcttggcctgggcagaattggaagagaggtg
gccgcccgaatgcaggcctttggaatgaagactgtaggctatgaccccatcatttctcca
gaagtcgctgcctcctttggtgttcagcagctgccgctagaggagatctggcctctctgt
gatttcatcactgtccataccccgctcctgccctccactacaggcttgctcaatgacagc
acctttgcccagtgcaagaaaggcgtgcgggtggtgaactgtgctcgaggaggcattgtg
gatgaaggtgccctgctccgtgccctgcagtctggtcagtgtgctggtgctgcactggat
gtgtttacagaagagccaccacgggaccgggccttagtggaccacgagaacgtcatcagc
tgtccccacctgggcgccagcaccaaggaggcccagagccgctgtggggaggaaatcgca
gtccagtttgtggacatggtgaaggggaaatctctaacaggggttgtaaacgcccaggct
cttaccagtgccttctctccacacaccaagccttggattggtctggcagaagcattgggc
acactgatgcacgcctgggctggctcccctaaagggaccatccaggtggtgacacaagga
acatctctgaagaatgctgggacctgcctgagccctgcggtcattgtcggccttctgaga
gaagcatcaaaacaggcagatgtgaacttggtgaacgctaagctactggtgaaagaggct
ggcctcaatgtcaccacctcccacagtcctggtgtcccaggagagcagggcatcggggaa
tgcctcctgactgtggccttggcaggtgctccctaccaagctgtgggcttggtccagggc
accacaccaatgttgcagatgctcaacggagctgtcttcaggccagaggtgcctctacgc
aggggccagcccctgctcctgttccgggctcagccctccgaccctgtcatgctgcccact
atgatcggcctactggcagaggcgggggtacagctgctgtcctaccagacctccaaggtg
tctgacggagacacttggcacgtcatgggcctctcctccctactgcccagcctggacgca
tggaagcagcatgtttctgaggctttccagttctgcttctga

DBGET integrated database retrieval system