KEGG   Rattus norvegicus (rat): 58936
Entry
58936             CDS       T01003                                 

Gene name
Plk3, Cnk, Fnk
Definition
(RefSeq) polo-like kinase 3
  KO
K08862  polo-like kinase 3 [EC:2.7.11.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    58936 (Plk3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    58936 (Plk3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    58936 (Plk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    58936 (Plk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    58936 (Plk3)
   03400 DNA repair and recombination proteins [BR:rno03400]
    58936 (Plk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     58936 (Plk3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   58936 (Plk3)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Polo kinases
    58936 (Plk3)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    58936 (Plk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr POLO_box Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 58936
NCBI-ProteinID: NP_071523
RGD: 62039
Ensembl: ENSRNOG00000018484
UniProt: Q9R011
Position
5q36
AA seq 647 aa
MEPAAGFLSPRPFPRAAAPSSPPAGPGPPASASPRSEPGVLAGPQTPDASRLITDPRSGR
TYIKGRLLGKGGFARCYEATDTETSIAYAVKVIPQSRVAKPHQREKIINEIELHRDLQHR
HIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRG
ILHRDLKLGNFFITDNMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPE
ADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPR
DRPSIEQILRHDFFTKGYTPDRLPVSSCVTVPDLTPPNPARSLFAKVTKSLFGRRKSKNK
NHSEEQDNVSCLVSGLMRTSIGHPDVRPEAPAASALAPVSLVETAAEDSSPRGTLASSGD
GFEEGLTVTTVVESALCALRNCVAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQ
LSSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGSVPRALQPQLGILRYFASYM
EQHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWE
PLLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggagcccgccgccggcttcttgtccccgcgccccttcccgcgcgcggctgctccgtcc
tcgccccccgccggtccggggccgcccgccagtgcctccccacggtcggaacctggggtg
ctggccgggccacagacgccggatgccagtcgcctcatcaccgaccctcgcagcggccgt
acctacatcaagggtcgcttgttgggcaaggggggcttcgctcgctgctatgaagccact
gacactgagactagtatagcctacgcggtcaaagtcatcccgcagagtcgcgtcgccaag
ccgcatcagcgcgagaagatcataaacgagatagagttgcaccgagacctacagcaccgc
catatcgttcgattttcgcatcatttcgaggatgctgacaacatatatattttcctggag
ctctgtagccgaaagtccctggcccacatctggaaggcccgtcacaccctactggaacca
gaggttcgctactacctgcgccagattctttctggtctcaagtacttgcaccagaggggt
atcttgcacagagatctcaagctgggaaattttttcatcactgataacatggaactgaag
gtgggagattttgggctggcagctcggctagagcctccagagcagaggaaaaagaccatc
tgtggtactcccaactatgtggccccagaagtgctgctgaggcagggccatggccccgag
gcagatgtgtggtcccttggttgtgtcatgtacacactcctgtgtgggagccccccgttt
gagacagctgacctaaaggagacctatcgctgcatcaagcaggttcattacacactgcct
gccagcctctcactgcctgcccgccagctcctggctgccatccttcgagcttcaccccga
gaccgcccttccattgagcagatcctgcgccatgacttctttacaaagggctacacccct
gatcggctccctgtcagcagctgtgtgacagtcccagatctgacaccccccaaccctgcg
aggagtctgtttgctaaagttaccaagagcctgtttggcaggagaaagagcaagaataag
aaccattctgaggaacaggataatgtctcctgcttggtgagcggcctcatgcgcacatcc
atcggtcatccagatgtcaggccggaggctccagcagcctcagctctggcccctgtcagc
ttggtagagacagctgctgaggacagctcaccccgtgggacactggcaagcagtggagat
ggatttgaagaaggtttgactgtgaccacggtggtggagtctgccctctgtgcactgaga
aactgtgtggccttcatgcccccagctgaacagaacccagccccgttggcacagccagag
cctctggtgtgggtcagcaagtgggttgactactccaacaagtttggctttggctatcag
ctgtccagccgccgtgtagccgtgctcttcaatgacggcacacacatggccctgtcagcc
aataggaagactgtgcactacaaccccaccagcacgaagcacttctctttctctgtgggt
tctgtgccccgtgctctgcagcctcagctgggcatcctccggtatttcgcctcctacatg
gagcagcacctcatgaagggtggagatctgcccagtgtggaggaggtagaggtccctgcc
ccacccttgctgctgcagtgggtcaagacggaccaggcccttctcatgctgttcagtgac
ggcactgtccaggtgaacttctacggggaccatacgaagctgatcctcagtggctgggag
cctctcctcgtgaccttcgtggcccgaaatcgcagtgcttgtacttacctcgcctcccac
ctccggcagctgggctgctccccagacttgcggcagcgactgcgctatgctctgcgcctg
ctcagggaccgaagccctgcttag

DBGET integrated database retrieval system