KEGG   Rattus norvegicus (rat): 58940
Entry
58940             CDS       T01003                                 

Gene name
H2afz, H2A.Z-1
Definition
(RefSeq) H2A histone family, member Z
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    58940 (H2afz)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    58940 (H2afz)
  09165 Substance dependence
   05034 Alcoholism
    58940 (H2afz)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    58940 (H2afz)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    58940 (H2afz)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    58940 (H2afz)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   58940 (H2afz)
SSDB
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 58940
NCBI-ProteinID: NP_073165
RGD: 621464
Ensembl: ENSRNOG00000010306
UniProt: P0C0S7
Position
2q44
AA seq 128 aa
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTV
NT seq 387 nt   +upstreamnt  +downstreamnt
atggctggcggtaaggctggaaaggactccggaaaggccaagacaaaggcggtttcccgc
tcccagcgagcgggcttgcagttccctgtgggccgtattcatcgacacctgaaatctagg
acaacaagccacggacgtgtgggcgcgaccgcagctgtgtacagcgcagccatcctggag
tacctcaccgcagaggtacttgagttggcaggaaatgcatcaaaagacttgaaggtaaag
cgtattacccctcgtcacttgcaacttgctatccgcggagatgaagagttggactctctg
atcaaggctacgattgctggtggtggtgtcatcccacacatccacaaatcactgattggg
aagaaaggacaacagaagactgtctaa

DBGET integrated database retrieval system