KEGG   Rattus norvegicus (rat): 58946
Entry
58946             CDS       T01003                                 

Gene name
Robo1
Definition
(RefSeq) roundabout guidance receptor 1
  KO
K06753  roundabout, axon guidance receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    58946 (Robo1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    58946 (Robo1)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  ROBO family
   58946 (Robo1)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig fn3 V-set C2-set_2
Other DBs
NCBI-GeneID: 58946
NCBI-ProteinID: NP_071524
RGD: 61941
Ensembl: ENSRNOG00000029614
UniProt: O55005
Position
11p11
AA seq 1651 aa
MKWKHLPLLVMISLLTLSKKHLLLAQLIPDPEDLERGNDNGTPAPTSDNDDNSLGYTGSR
LRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPRSHRM
LLPSGSLFFLRIVHGRKSRPDEGVYICVARNYLGEAVSHNASLEVAILRDDFRQNPSDVM
VAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVC
VGTNMVGERESKVADVTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTFGWRKDDG
ELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEPPHFVVKPRDQ
VVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTVTNVQR
SDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTLTLSCVATG
SPVPTILWRKDGVLVSTQDSRIKQLESGVLQIRYAKLGDTGRYTCTASTPSGEATWSAYI
EVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSKNTVTLLWQPNLNSGATPTSYIIEAFS
HASGSSWQTVAENVKTETFAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKTQDVPPT
TQGVDHKQVQRELGNVVLHLHNPTILSSSSVEVHWTVDQQSQYIQGYKILYRPSGASHGE
SEWLVFEVRTPTKNSVVIPDLRKGVNYEIKARPFFNEFQGADSEIKFAKTLEERPSAPPR
SVTVSKNDGNGTAILVTWQPPPEDTQNGMVQEYKVWCLGNETRYHINKTVDGSTFSVVIP
FLVPGIRYSVEVAASTGAGPGVKSEPQFIQLDSHGNPVSPEDQVSLAQQISDVVKQPAFI
AGIGAACWIILMVFSIWLYRHRKKRNGLSSTYAGIRKVPSFTFTPTVTYQRGGEAVSSGG
RPGLLNISEPATQPWLADTWPNTGNSHNDCSINCCTASNGNSDSNLTTYSRPADCIANYN
NQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYATTQLIQ
ANLINNMNNGGGDSSEKHWKPPGQQKQEVAPIQYNIMEQNKLNKDYRANDTILPTIPYNH
SYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKAPKQGGMNWADLLPPPPAHPPPHSNSE
EYSMSVDESYDQEMPCPVPPARMYLQQDELEEEEAERGPTPPVRGAASSPAAVSYSHQST
ATLTPSPQEELQPMLQDCPEDLGHMPHPPDRRRQPVSPPPPPRPISPPHTYGYISGPLVS
DMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTGSMINGWGSASEE
DNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKVARRQMQDAAGRRHFHASQCPRP
TSPVSTDSNMSAAVIQKARPTKKQKHQPGHLRREAYTDDLPPPPVPPPAIKSPSVQSKAQ
LEARPIMGPKLASIEARADRSSDRKGGSYKGREALDGRQVTDLRTSPGDPREAQEQPNEG
KARGTKTAKRDLPPAKTHLIPEDILPYCRPTFPTSNNPRDPSSSSSMSSRGSGSRQREQA
NVGRRNMAEMQVLGGFERGDENNEELEETES
NT seq 4956 nt   +upstreamnt  +downstreamnt
atgaaatggaaacatcttcctcttctggtcatgatatctctcctcactctatcaaaaaag
catctccttctggcccagcttattccagaccctgaggacctagagagggggaacgacaac
gggacgccagcccccacctctgataatgatgacaattcgctgggctacacaggctcccgt
ctccgtcaggaagatttcccaccgcgcattgttgagcacccttcagacctgatcgtctct
aaaggggaacccgccaccctcaactgtaaagctgaaggccgccctaccccgactatagaa
tggtacaagggcggcgaaagagtggaaacggacaaagacgaccctcgctcacaccgaatg
ctgctgccaagtggatctttatttttcttacgcatagtgcatggacggaagagtaggcct
gacgaaggggtctacatctgtgtagcaaggaattacctcggagaggctgtgagccacaat
gcatcgctggaggtagctatactacgggatgacttcagacaaaacccttcagatgttatg
gtggcggtgggcgagcctgcagtaatggaatgccagcctcctcggggccacccagagccc
accatctcctggaaaaaggatggctcacccctggatgataaagacgagcgaatcactatc
cgaggcgggaagctcatgatcacgtacacccgtaaaagcgatgctggcaagtatgtttgt
gttggtaccaacatggtaggggagcgggagagcaaagtcgcggacgtgactgtcttagag
agaccgtcctttgtaaagagacccagtaatttggcagtgactgtggatgacagtgctgag
tttaagtgtgaggcccgaggagaccccgtgcctacgttcgggtggaggaaagatgacgga
gagctgcccaaatccagatatgagatccgagatgatcatactttgaaaattcggaaggtg
acagctggcgacatgggatcatacacttgtgttgcagaaaatatggttgggaaagccgaa
gcatcagccactttgacagttcaagagccaccacattttgtcgtgaagcctcgagaccag
gtggttgccttggggcgaactgtgacttttcagtgtgaagcaactggaaatcctcaacca
gctatcttttggcggagagaggggagtcagaatctgcttttctcataccagcctccacag
tcctctagccggttttcagtttcccagacgggggacctcactgttacgaacgtccagagg
tctgatgtcggttactatatctgtcagactttgaacgtggctggaagcatcatcacaaag
gcatatttggaagttactgatgtgattgcggaccggcctcccccagtcatccgacaaggt
cctgtgaatcagactgtagcagtggatggtactttaactctcagctgtgtggccacaggc
agtcccgtgcccacaattctgtggaggaaggatggagtccttgtttcaacccaagattct
cggatcaaacagctggagagcggggtcctgcagatccgctacgctaagctgggtgacacc
ggtcggtacacctgcactgcttcgacccccagtggtgaggccacgtggagcgcttacatc
gaagtccaggaatttggagttccagttcaacctccaagacccaccgaccccaatttaatc
cccagtgcgccttcaaagcctgaagtcacagatgtgagcaaaaacacagtcactttattg
tggcagcctaacctgaactcaggagcaaccccaacgtcttatattatagaagccttcagc
catgcatctggtagcagctggcagaccgtggcagaaaatgtgaaaacagaaacattcgcc
atcaaagggctcaaacctaatgcgatctaccttttcctggtgagggcagcaaatgcctat
gggattagcgatccaagccaaatatccgatccagtgaaaacacaagatgtcccaccaacc
acccaaggggtggaccacaagcaggtccagagagaactgggcaatgttgtcttgcatctc
cacaaccctaccatcctttcttcctcttctgtcgaagtgcactggacggtggaccaacaa
tctcaatatattcaaggttataaaattctctaccgaccatctggagccagccatggcgaa
tcggagtggttagtttttgaagtgaggaccccaaccaaaaatagtgtggtgatccccgat
ctgagaaaaggcgtcaactacgagattaaggcccgcccattttttaatgagttccaagga
gcagatagtgaaatcaaatttgccaaaaccttagaagaacgaccaagtgcccctccccga
agtgtcactgtatccaagaatgatggaaatgggacagcaattctggtcacttggcaaccg
cctcctgaagacacacagaatggaatggtccaagaatataaggtttggtgtctcgggaat
gagactaggtatcacataaacaagacagtagatggctctaccttttcggtggtcattccc
tttcttgttcctggaatccgctacagtgtagaagtggctgcaagcactggggctggccct
ggggtgaagagtgagccccagttcatccagttggattcccatggaaaccccgtgtctccc
gaggaccaagtgagcctggctcagcagatctccgacgtggtgaagcagccagccttcatt
gcgggcatcggggccgcctgttggatcattctcatggtcttcagtatctggctttaccga
caccgcaagaagagaaacgggctcagcagcacgtacgcggggatccggaaagtcccgtcc
tttaccttcacaccaacagtaacttatcaaagaggaggcgaagccgtcagcagtggaggg
aggccgggactcctcaacatcagtgaacctgccacacagccatggctggcggacacgtgg
cccaacacaggcaacagtcacaatgactgctccatcaactgctgcacagccagcaacggc
aacagcgacagcaacctgaccacctacagtcgcccagctgattgtatagcaaattataac
aaccaactggataacaaacaaacaaatctgatgctccctgagtcaactgtttatggtgat
gtggaccttagtaacaaaatcaatgagatgaaaaccttcaatagcccaaatctgaaggat
gggcgttttgtcaatccatcagggcagcccactccctacgccaccacgcagctcatccag
gcaaatctcatcaacaatatgaataacggcggcggggactccagcgagaaacactggaag
cctccggggcagcagaaacaggaagtggcaccaattcagtataacatcatggagcaaaac
aagttgaacaaagattatcgggcaaatgacacaatccttccaaccatcccgtacaaccat
tcntatgaccagaatacaggaggatcctacaacagctcagatcggggcagtagtacatct
gggagtcaaggccacaagaaaggggcacggacaccaaaggcacccaagcagggtggcatg
aactgggcagacttgctgccccctcccccagcgcatcctcccccacacagcaacagcgag
gaatacagcatgtctgtagatgaaagctatgatcaagaaatgccgtgccctgttccgcct
gcacggatgtatttgcaacaggatgaattagaagaagaggaagctgaaagaggccccacg
ccccctgtccggggggcagcttcgtccccagctgctgtgtcctacagccatcagtccacg
gccactctcaccccgtctccccaggaagagctccagcctatgttacaggattgtccggag
gacctcggccacatgccccacccaccagacaggaggcggcagccggtgagtcctcctcca
ccaccacggccaatttccccaccacatacttacggctacatttcaggacccctggtctca
gacatggatacggatgccccagaagaggaggaagacgaagctgacatggaagttgctaag
atgcagacccgaaggctgttgttacgtgggcttgaacagaccccagcatctagtgttggg
gacctcgagagctcggtcactggctccatgatcaatggctggggctcagcctcagaagag
gacaacatttccagtgggcgctccagtgtcagttcatcggatggttcctttttcactgac
gcggattttgcccaggcagttgcagcagccgccgagtatgcgggcctgaaggtggctcgc
cgccagatgcaggatgctgctggccgccgacacttccatgcctcccagtgccctaggccc
acgagtcctgtgtctacagacagcaacatgagtgctgctgtaatccagaaagccagaccc
accaagaaacagaagcaccagccaggacatctgcgcagagaggcctacacagatgatctt
ccaccacctccagtgccaccgcctgctataaaatcgcccagtgtccagtccaaggcacag
ctggaggcacggcctataatggggccaaagctcgcttctatagaagcgagagcagacaga
tcatcagacagaaaaggcggcagttacaaggggagagaagctctggacggaagacaagtc
actgacctgcgaacaagcccaggtgaccccagagaagcacaggagcagccaaacgaaggg
aaagcacgagggacgaagacagcaaagcgagaccttccaccagcgaagacacacctcatc
ccagaggatatccttccgtactgtaggcctactttcccaacgtcaaacaaccctagggat
cccagttcttcaagctcaatgtcatcaagaggctcaggaagccgacagagagagcaagca
aatgtgggccgaagaaatatggcagaaatgcaagtacttgggggatttgaaagaggagat
gagaataatgaagaattagaggaaactgaaagctga

DBGET integrated database retrieval system