KEGG   Rattus norvegicus (rat): 58968
Entry
58968             CDS       T01003                                 

Gene name
Acan, Agc, Agc1
Definition
(RefSeq) aggrecan
  KO
K06792  aggrecan 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    58968 (Acan)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    58968 (Acan)
   04091 Lectins [BR:rno04091]
    58968 (Acan)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   58968 (Acan)
Glycosaminoglycan binding proteins [BR:rno00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   58968 (Acan)
Lectins [BR:rno04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   58968 (Acan)
SSDB
Motif
Pfam: Xlink Lectin_C V-set EGF Sushi I-set hEGF ig EGF_CA Ig_3 DUF166
Other DBs
NCBI-GeneID: 58968
NCBI-ProteinID: NP_071526
RGD: 68358
Ensembl: ENSRNOG00000028992
UniProt: P07897
Structure
PDB: 
1TDQ

Position
1q31
AA seq 2162 aa
MTTLLLVFVTLRVIAAVISEEVPDHDNSLSVSIPQPSPLKALLGTSLTIPCYFIDPMHPV
TTAPSTAPLTPRIKWSRVSKEKEVVLLVATEGQVRVNSIYQDKVSLPNYPAIPSDATLEI
QNLRSNDSGIYRCEVMHGIEDSEATLEVIVKGIVFHYRAISTRYTLDFDRAQRACLQNSA
IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQGGMDMCSAG
WLADRSVRYPISKARPNCGGNLLGVRTVYLHANQTGYPDPSSRYDAICYTGEDFVDIPEN
FFGVGGEEDITIQTVTWPDLELPLPRNITEGEARGNVILTAKPIFDMSPTVSEPGEALTL
APEVGTTVFPEAGERTEKTTRPWGFPEEATRGPDSATAFASEDLVVRVTISPGAVEVPGQ
PRLPGGVVFHYRPGSTRYSLTFEEAQQACIRTGAAIASPEQLQAAYEAGYEQCDAGWLQD
QTVRYPIVSPRTPCVGDKDSSPGVRTYGVRPSSETYDVYCYVDKLEGEVFFATQMEQFTF
QEAQAFCAAQNATLASTGQLYAAWSQGLDKCYAGWLADGTLRYPIVNPRPACGGDKPGVR
TVYLYPNQTGLPDPLSKHHAFCFRGVSVVPSPGGTPTSPSDIEDWIVTRVEPGVDAVPLE
PETTEVPYFTTEPEKQTEWEPAYTPVGTSPLPGIPPTWLPTVPAAEEHTESPSASQEPSA
SQVPSTSEEPYTPSLAVPSGTELPSSGDTSGAPDLSGDFTGSTDTSGRLDSSGEPSGGSE
SGLPSGDLDSSGLGPTVSSGLPVESGSASGDGEIPWSSTPTVDRLPSGGESLEGSASASG
TGDLSGLPSGGEITETSASGTEEISGLPSGGDDLETSTSGIDGASVLPTGRGGLETSASG
VEDLSGLPSGEEGSETSTSGIEDISVLPTGESPETSASGVGDLSGLPSGGESLETSASGV
EDVTQLPTERGGLETSASGIEDITVLPTGRENLETSASGVEDVSGLPSGKEGLETSASGI
EDISVFPTEAEGLETSASGGYVSGIPSGEDGTETSTSGVEGVSGLPSGGEGLETSASGVE
DLGLPTRDSLETSASGVDVTGYPSGREDTETSVPGVGDDLSGLPSGQEGLETSASGAEDL
GGLPSGKEDLVGSASGALDFGKLPSGTLGSGQTPEASGLPSGFSGEYSGVDIGSGPSSGL
PDFSGLPSGFPTVSLVDSTLVEVITATTASELEGRGTISVSGSGEESGPPLSELDSSADI
SGLPSGTELSGQTSGSLDVSGETSGFFDVSGQPFGSSGTGEGTSGIPEVSGQAVRSPDTT
EISELSGLSSGQPDVSGEGSGILFGSGQSSGITSVSGETSGISDLSGQPSGFPVLSGTTP
GTPDLASGAMSGSGDSSGITFVDTSLIEVTPTTFREEEGLGSVELSGLPSGETDLSGTSG
MVDVSGQSSGAIDSSGLISPTPEFSGLPSGVAEVSGEVSGVETGSSLSSGAFDGSGLVSG
FPTVSLVDRTLVESITLAPTAQEAGEGPSSILEFSGAHSGTPDISGDLSGSLDQSTWQPG
WTEASTEPPSSPYFSGDFSSTTDASGESITAPTGSGETSGLPEVTLITSELVEGVTEPTV
SQELGHGPSMTYTPRLFEASGEASASGDLGGPVTIFPGSGVEASVPEGSSDPSAYPEAGV
GVSAAPEASSQLSEFPDLHGITSASRETDLEMTTPGTEVSSNPWTFQEGTREGSAAPEVS
GESSTTSDIDAGTSGVPFATPMTSGDRTEISGEWSDHTSEVNVTVSTTVPESRWAQSTQH
PTETLQEIGSPNPSYSGEETQTAETAKSLTDTPTLASPEGSGETESTAADIDECLSSPCL
NGATCVDALDTFTCLCLPSYRGDLCEIDQEQCEEGWTKFQGHCYRHFPDRETWVDAERRC
REQQSHLSSIVTPEEQEFVNKNAQDYQWIGLNDRTIEGDFRWSDGHSLQFEKWRPNQPDN
FFATGEDCVVMIWHERGEWNDVPCNYQLPFTCKKGTVACGEPPAVEHARTLGQKKDRYEI
SSLVRYQCTEGFVQRHVPTIRCQPSADWEEPRITCTDPNTYKHRLQKRTMRPTRRSRPSM
AH
NT seq 6489 nt   +upstreamnt  +downstreamnt
atgaccactttactcttggtctttgtgactctgcgggtcatcgctgcagtgatctcagaa
gaagttccagaccatgacaactcactgagtgtgagcatccctcaaccatccccactgaag
gccctcctagggacttccctcaccatcccctgctacttcatcgaccccatgcatcctgtg
accactgctccctccactgcccccctcaccccaagaatcaagtggagccgtgtttccaag
gaaaaggaggtggtactgttggtggccactgaaggacaggttcgagtgaacagcatctac
caagacaaggtgtcacttcccaactatccagccatccccagcgatgccaccttggaaatc
cagaaccttcgctccaatgactctgggatctatcggtgtgaagtgatgcatggcattgag
gacagcgaagccaccctggaggtcatagtaaaaggcattgtgttccactacagagctatt
tccacacgctacacactggactttgaccgagcccagcgggcttgccttcagaacagcgcc
atcatcgccacccctgagcaactgcaggccgcctatgaggatggcttccaccagtgtgat
gcaggctggctggctgatcagacagtcagataccccatccacactccccgggaaggttgc
tatggtgacaaggacgagttccctggagtgaggacctatggaatccgagacaccaacgag
acctatgatgtgtactgcttcgctgaagagatggagggtgaggtcttttatgccacatcc
ccggagaaattcaccttccaggaggcagccaacgagtgccggaggctgggggcacggttg
gccaccacaggccagctctaccttgcctggcagggcggtatggacatgtgcagcgctggc
tggctggcggaccgcagcgttcgctaccccatctccaaggctcggcccaactgcggaggc
aacctcctgggtgtaaggactgtctatctgcacgccaaccagacaggctaccctgatccc
tcatcccgctacgacgccatctgctacacaggtgaagactttgtagacatcccagaaaac
ttcttcggagtgggtggtgaagaggacatcaccatccagacagtgacctggccagatctg
gagctgcccctgccccgtaatattacggagggagaagcccggggcaatgtgatcctcact
gcaaagcccatcttcgacatgtcccccactgtctcagagcctggggaggccctcacactt
gcccctgaagtggggaccacagtcttccctgaggctggggagagaactgaaaagaccacc
aggccctggggctttcccgaggaagccacacgtgggcctgattctgccactgccttcgcc
agtgaggacctggtggtgcgagtgaccatctctccaggtgcagttgaggtccctggtcag
ccccgcttgccagggggagttgtattccactaccgcccgggctctaccagatactctctg
acatttgaggaggcacagcaggcctgcattcgcacgggagcagccatagcttctcctgag
caactccaggctgcctatgaggcaggctatgagcagtgtgatgctggctggctgcaggac
cagactgtcagataccccattgtgagcccacggaccccatgtgtgggtgacaaggacagc
agccccggagtcaggacctatggcgtgcgcccatcatcagaaacctatgatgtctactgc
tacgtggacaagcttgagggggaagtgttcttcgccacacaaatggagcagttcaccttc
caggaagctcaggccttctgtgcagctcaaaatgctaccctggcctccactggccagctc
tacgctgcctggagccagggcctggacaagtgctatgctggctggttggcagatggcacc
ctccgataccccatcgtcaaccctcggcctgcctgtggtggtgacaagccgggcgtgaga
actgtctacctctaccccaaccagaccggcctccctgatccactgtccaagcaccatgcc
ttctgcttccgaggtgtgtcagtggtgccctctccaggtggtacacccacatcgccctct
gacatagaggactggatcgtcactcgagtggagcctggcgtggatgctgtccccttggag
ccggagacgacagaagtaccatatttcaccactgagccagaaaaacagactgaatgggag
ccagcctacaccccagtgggcacatccccattgccagggatccctcccacatggcttccc
accgtcccagcagcagaggaacacaccgaaagtccctctgcctctcaagagccctctgcc
tcgcaagtcccttccacatcagaagagccatacacaccttcacttgcagtgccaagcggg
accgagctgcccagctcaggggacacatcaggggcacctgacctcagtggtgacttcaca
ggcagcacagacacttcaggacgccttgactccagtggggagccatcaggaggcagtgaa
agtggacttccctctggcgaccttgactccagtggtctcggccccacagtgagctcaggc
ttgcctgtagaaagtgggtcagcctcgggagatggagaaatcccctggtcgagcactccc
acagttgacagactgccctctggaggtgagagccttgaaggttctgcctctgcctctgga
acaggagaccttagtgggctgccttcaggaggggaaattacagaaacttctgcttctggg
acagaagaaatcagtggacttccttctggaggagacgatctagaaacttctacctctgga
atagatggagccagtgtgcttcctactggaagaggaggtctagagacgtctgcctctgga
gtagaggacctcagtggacttccttctggagaagaaggttcagaaacatctacctctgga
atagaggacattagtgtacttccgactggagaaagtccagaaacttctgcttctggagtg
ggagacttgagtggacttccctcaggaggagaaagtctagaaacatctgcttcaggtgta
gaggatgtcacccagcttcctactgaaagaggaggtctagagacttctgcctctggaata
gaggacatcactgtgcttcctactggaagagaaaatctagaaacttctgcctctggagta
gaggatgtcagtggacttccttctggaaaagaaggtctagagacttctgcctctggaata
gaggacattagtgtgttccctactgaagcagaaggtctagaaacttctgcctccggggga
tatgtcagtgggattccttctggagaagatggtacagaaacctctacttctggagtagag
ggtgtgagtggtcttccttctggaggagagggtctagaaacgtctgcctctggagtagaa
gatcttggtcttcctacaagagatagtctagagacttctgcctcaggagtagatgttact
gggtatccttctggaagagaggacacagaaacctctgttcctggggtaggtgatgacctt
agtggacttccttctggacaagaaggcctagagacctcagcttcaggagctgaggacctt
ggtggcttgccttctggaaaagaagacttggtagggtctgcttctggagccctggacttc
ggcaagctaccttctggaactctaggaagtggtcaaactccagaagctagtggccttccc
tctggatttagtggtgaatattctggagtggacattggaagtggcccatcctctggcctg
cctgactttagtggacttccatccggcttcccaacagtctcccttgtggacagtacctta
gtggaagtgatcacagccaccactgccagtgaactggaaggaagggggaccatcagcgtc
agtggttcaggagaagagtcagggccgcccctcagtgagttggacagtagtgcggacatt
agtggtctcccttcaggaactgaactcagtggccaaacatccggatctcttgatgtcagt
ggagaaacatctggattttttgatgttagtggacagccatttgggtcttctggcactggt
gagggaacatctgggattcctgaagtcagtggacaggccgtcaggagtcctgacaccact
gagatatctgagcttagtggactgtcctctgggcaaccagatgtcagtggagaagggtct
ggaattctctttggcagtggccaatcctctggcataacatctgtgagtggagaaacctct
gggatttctgatctcagtgggcaaccttcagggttcccagtgctcagcggaacaacacct
ggaacccctgacctggcttctggcgccatgagtggcagtggagattcttctggcattacg
tttgtggacaccagtcttattgaagtgacccctaccacatttagagaagaagaggggtta
gggtctgtggaactcagtggcctcccttctggggagacagatctgtctggcacatctggg
atggtggatgtcagtggacaatcttctggagcaatcgattccagtggactcatatccccc
actccagaattcagtggcctcccaagcggagtagctgaggtcagtggagaggtctctgga
gttgagactgggagcagcttgtcctcgggagcattcgatggcagtggacttgtctcaggt
ttccctacggtgtctcttgtagacagaactttggtggagtctataaccctggctcctact
gctcaagaagctggagaagggccttccagcattttggaattcagtggtgcccattctgga
acaccagacatatctggggacctctctgggtctttagaccaaagcacatggcagcctggg
tggacagaagccagcacagagccaccaagctccccatattttagtggggacttctctagc
accactgatgcaagtggagaatccataactgccccaactggcagtggggaaacctcgggg
cttccggaagtcactttaatcacttcagagttagtggagggcgtgactgaaccaactgtt
tcccaggaacttggccatggtccttctatgacatatactccccggctctttgaggccagt
ggggaagcctcagcatctggggaccttggtggacctgtaacaatctttcccgggtctggg
gtagaagcttcagtcccagaaggcagcagtgacccatctgcttaccctgaggctggagtg
ggagtgtctgctgcccctgaggccagcagtcaattgtctgagttcccagatctgcatgga
atcacctctgcctcccgtgaaacagatctggagatgacaaccccaggcacggaggtgagc
agcaacccatggacctttcaggaaggcaccagggagggatccgctgctccagaagtgagt
ggagaatctagcactacctccgacatagatgcaggcacttcaggtgtgccttttgccacg
cccatgacttctggagacaggactgaaatcagtggagaatggtctgatcatacctcagag
gtgaatgttaccgtcagcaccaccgtcccagagtccaggtgggcccagtctacccagcac
cctacagagacacttcaagaaatcggatccccaaatccctcatactcaggagaagagacc
caaacagcagaaacagccaagtccctgacagacacccctacccttgcttctccagaaggg
tcaggagaaacagagtcaaccgctgcagacattgatgagtgcctctcaagcccttgtctg
aatggagccacctgcgtggatgccttggacactttcacatgcttatgccttccgagctac
agaggggacctgtgtgagatcgaccaggagcaatgtgaggaggggtggaccaagttccag
ggccactgttatcgccactttcccgaccgcgagacctgggtggatgcagagagacggtgt
cgggagcagcagtcacatctgagcagcatcgtcacccctgaggaacaggagttcgtcaac
aaaaatgctcaagactaccagtggatcggtctgaatgacagaaccatcgaaggggacttc
cgctggtctgatggacactccctgcaatttgagaagtggcgtccaaaccaacccgacaat
ttctttgccactggagaggactgcgtagtgatgatctggcatgagaggggtgaatggaac
gatgtcccctgcaattaccagctgcccttcacatgtaaaaagggcacagtggcctgtgga
gaacccccagcggtggagcatgccagaacccttgggcagaagaaagatcgctatgagatc
agctccctggtgcggtaccagtgtactgagggctttgtccagcgccatgtgcccaccatc
cggtgtcagcccagtgcggactgggaagagcctcgaatcacttgcacagaccccaacacc
tacaagcacaggctacagaagcggacgatgagacccacacggaggagccgccccagcatg
gcccactga

DBGET integrated database retrieval system