KEGG   Rattus norvegicus (rat): 60355Help
Entry
60355             CDS       T01003                                 

Gene name
Nsf
Definition
(RefSeq) N-ethylmaleimide sensitive factor, vesicle fusing ATPase
  KO
K06027  vesicle-fusing ATPase [EC:3.6.4.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04727  GABAergic synapse
rno04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    60355 (Nsf)
  09156 Nervous system
   04727 GABAergic synapse
    60355 (Nsf)
   04721 Synaptic vesicle cycle
    60355 (Nsf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    60355 (Nsf)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.6  vesicle-fusing ATPase
     60355 (Nsf)
Membrane trafficking [BR:rno04131]
 SNARE
  SNARE associated proteins
   Others
    60355 (Nsf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA CDC48_N AAA_lid_3 CDC48_2 AAA_22 AAA_16 RuvB_N RNA_helicase AAA_2 AAA_5 AAA_14 AAA_33 AAA_18 TIP49 Mg_chelatase ATPase_2 AAA_24 NACHT TsaE AAA_28 ABC_tran ATPase NB-ARC AAA_3 IstB_IS21 AAA_7 Rad17
Motif
Other DBs
NCBI-GeneID: 60355
NCBI-ProteinID: NP_068516
RGD: 621594
Ensembl: ENSRNOG00000003905
UniProt: Q9QUL6
Position
10q32.1
AA seq 744 aa AA seqDB search
MAGRTMQAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCI
AFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAE
FIQQFNHQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGN
SQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVF
PPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEA
NIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDG
VEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLL
SADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDF
LASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVL
LEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCV
VVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNA
FSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQM
DPEYRVRKFLALMREEGASPLDFD
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggcgggccggactatgcaagctgcgagatgccctactgatgaattgtctctaagcaac
tgtgcagttgtgaacgaaaaggattaccagtctggccagcatgtgatggtgaggacgtcc
cccaaccacaagtacatatttacgctgcggacccatccgtccgtggttcccggatgcatc
gcgttcagcttaccccagcgaaaatgggctggactttctattgggcaggacatagaagtc
gccttgtattcgtttgacaaagccaagcagtgcatcggcacaatgaccatcgagatcgac
ttcctgcagaaaaagaacatcgactccaacccttacgacaccgacaagatggctgccgag
ttcatccagcagttcaaccaccaggccttctcagtgggacagcagcttgtctttagcttc
aatgataagctctttggattgctggtgaaggacatcgaagccatggatcccagcatcctg
aagggagagcctgcgtcaggtaaaaggcagaagattgaagtaggactggtcgttggaaac
agtcaagttgcatttgaaaaagcagaaaactcatcactcaatcttattggcaaggctaaa
accaaggaaaatcgccagtctatcatcaatcccgactggaactttgagaaaatggggatc
ggcggtctggataaggagttttcagatattttccgacgagcatttgcttctcgggtgttc
cctccggagatcgtggaacaaatgggttgcaaacatgttaaaggcatcctgttatacgga
ccccctggttgtggtaagactctcttggctcgacagattggcaagatgctgaatgcaaga
gagcccaaggtggtcaatgggccggaaatccttaacaaatatgtgggagaatcagaggcc
aacatccgcaagctctttgctgatgcagaagaggagcagagacggctcggtgccaacagc
ggcctgcacatcatcatctttgatgaaatcgacgccatctgcaagcagagagggagcatg
gccggcagcaccggggtgcacgacactgtggtcaaccagctgctgtccaagatcgatggc
gtcgagcagctgaacaacatcctcgttattggaatgaccaatcgaccagatttgattgat
gaggctctccttcgacctggaagactggaagttaagatggagataggcttaccagatgag
aagggccgactgcagatccttcacatccacacagcaaggatgcgagggcaccagctactg
tctgcggatgtggacatcaaggaactggctgtggagactaagaatttcagtggcgccgag
ctggagggcctggtgcgagcagcgcagtccacagccatgaacagacacataaaggccagc
acaaaagtggaagtagacatggagaaggcagagagcctgcaggtgacaagaggggacttc
ctcgcttccctggagaatgatatcaaaccggcattcggcacaaaccaagaggactatgca
agttacattatgaatggaatcatcaagtggggtgaccccgtgacccgagtcctcgacgac
ggagagctgctggtccagcagactaaaaacagtgaccgcacaccgctggttagcgtcctt
ctggaaggccctcctcacagcgggaagactgccctcgctgcaaagattgccgaggaatca
aacttccccttcatcaagatctgctcccccgataagatgattgggttctctgagacagcc
aagtgtcaggccatgaagaagatctttgatgatgcttacaaatctcagctcagttgtgtg
gtcgtggatgacattgagaggttgctcgattacgtccccatcggcccccggttctccaac
ctggtgttacaagctctgctcgtgttactgaaaaaggcacctcctcagggccgcaagctt
ctcatcatcgggaccaccagccgcaaagatgtcctgcaggaaatggagatgctcaacgcc
ttcagcaccaccatccacgtgcccaacatcgccacaggagagcagctgctggaagctctg
gagcttttgggcaacttcaaagataaggaacgcaccacaattgctcagcaagtcaaaggg
aagaaagtctggataggaatcaagaagttactaatgttgattgagatgtccctgcagatg
gaccctgagtaccgtgtgaggaaattcttggccctcatgagagaagaaggcgctagtccc
ctggactttgactga

DBGET integrated database retrieval system