KEGG   Rattus norvegicus (rat): 60379Help
Entry
60379             CDS       T01003                                 

Gene name
Col5a3
Definition
(RefSeq) collagen type V alpha 3 chain
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    60379 (Col5a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    60379 (Col5a3)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   60379 (Col5a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_3 Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 60379
NCBI-ProteinID: NP_068528
RGD: 70922
Ensembl: ENSRNOG00000020525
UniProt: Q9JI04
Position
8q13
AA seq 1737 aa AA seqDB search
MRSCRRLDQLQAGLCLLLASLQLVSWTLAAEPVDVLETLGVHRDKAGVTKGPGFCPQRIP
QGDRAFRVGKSSLLSVPTWQLFPDGHFPENFSVLLTLRAQPANQSVLLSIYDENGVRQMG
LALGPALGLLGDSFRSLPKQINLMDGRWHRVAVSISGDKVTLVVDCEPQPPMFGQGPRVI
STAGLTVMGTQELGEESFEGDIQELLLIPDPQAALQACELYLPDCETPDSTTTGVTKEEP
ETPAPRRRKGKGKKKDRGRKGKGRKKNKTSRLSPTPGAPENQTSLHTPETEKPSPHLPPT
PTPLAITTTVTMGGNATVLQGLDSSTETEQMTPEMDATEESEGGGPTMGPEFRAAEQSLQ
TEFQIFPGAGEKGAKGEPATIEQGQQFEGPAGAPGPRGISGPSGPPGPPGFPGDRGLPGP
AGLPGIPGIDGVRGLPGTVIMMPFHFASGSMKGPPVSFQQAQAQAVLQQAQLSMKGPPGP
VGLTGRPGPVGLPGYPGLKGELGEAGPQGPRGLQGPPGPPGREGKTGRAGADGARGLPGD
TGPKGDRGFDGLPGLPGEKGQRGDFGPVGQPGPPGEDGIKGLQGPPGPTGQAGEPGPRGL
IGPRGPPGPLGRPGVTGSDGAPGAKGNVGPPGEPGPPGQQGNHGSQGIPGPQGPIGTPGE
KGPPGNPGIPGVPGSEGPPGHPGHEGPTGEKGAQGPPGSAGPQGYPGPRGVKGTSGNRGL
QGEKGERGEDGFPGFKGDEGPKGDRGNPGLPGPRGEDGPEGQKGPEGLPGDEGPPGAAGE
KGKLGVPGLPGYPGRPGPKGSIGFPGPLGPLGEKGKRGKAGQPGEEGERGTPGTRGDRGQ
PGATGQPGPKGDVGQNGSPGAPGEKGLPGLQGPPGFPGPKGPPGPQGKDGIPGHPGQRGE
LGFQGQTGPPGPAGVLGPQGKVGDVGPLGERGPPGPPGPPGEPGLPGIEGREGAKGELGP
LGSLGKEGPPGPMGFPGPQGAPGDPGPIGLKGDKGPPGPLGANGSPGERGPVGPSGGIGL
PGQSGGQGPIGPAGEKGSPGERGVPGPTGKDGIPGPPGLQGPPGAAGPSGEEGDKGEVGM
PGHKGSKGDKGDAGPPGPTGIRGPAGHPGPPGADGAQGRRGPPGLFGQKGDDGVRGFVGV
IGPPGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPPGPSGSAGSPGLPGGVGQPGAVGE
KGEPGNAGDAGPPGVPGIPGPKGEIGEKGDSGPSGAAGPPGKKGPPGEDGAKGNMGPTGL
PGDLGPPGDPGVPGTDGIPGEKGNAGDIGGPGPPGASGEPGARGLPGKRGSPGRMGPEGK
EGEKGAKGDAGPDGPPGRTGPIGARGPPGRVGPDGLPGIPGPVGEPGLLGPPGLIGPPGP
LGPPGLPGLKGDAGLKGEKGHIGLIGLIGPPGEAGEKGDQGLPGVQGPPGLQGDPGLPGP
VGSLGHPGPPGVVGPLGQKGSKGSPGSLGPRGDPGPAGPPGPPGSPAEVHGLRRRRSVLD
TPEGGLEEVMASLNSLSLELEQLQRPPGTAESPGLICHELHRNHPHLPDGEYWIDPNQGC
ARDAFKVFCNFTAGGETCLYPDKKFETVKLASWSREKPGGWYSTFRRGKKFSYVDADGSP
VNVVQLTFLKLLSAAAHQRFTYTCQNSAAWLDEASGDHRHSIRFQGTNWEELSFNQTTAA
TIKVPHDGCRVRKGQAKTLFEFSSSVGFLPLWDVAAVDFGQTNQKFGFELGSVCFSS
NT seq 5214 nt NT seq  +upstreamnt  +downstreamnt
atgagaagctgccggagactggaccagcttcaggccggcctctgcctgctcctggcctcc
ctacaactcgtgtcctggacgctggctgcagaacctgtggatgtattggaaaccttgggt
gtgcatagggacaaggctggggtgaccaaagggcctggcttctgcccccagaggattcca
cagggtgaccgagcattcagggtgggcaagtccagccttctcagcgtccccacatggcag
ctctttccagatggacattttcctgagaacttttctgtgctgctcactctgcgggcccag
ccagccaatcaatctgtccttctgtctatatatgacgagaatggtgtccggcagatgggg
ctggcactggggccagctctgggtctccttggtgactctttcaggtctcttcccaagcag
atcaaccttatggatggcaggtggcaccgggtggcggtcagcatcagcggtgacaaggtg
accctggtggttgactgtgaacctcagccccccatgtttggtcaggggcctcgggttata
agtacagctggactcacggtgatgggaacccaggagctcggggaggagtcttttgaggga
gacatccaggagctgctgttaattccagaccctcaggctgctctccaggcctgtgagctc
tacctgcctgactgtgagacccccgattccacaaccacaggggtcactaaagaagaacca
gaaacacctgcccctcgtcgacgaaagggcaaaggaaagaaaaaagatcggggtcgcaag
ggcaagggaagaaagaaaaacaagacctcaagactgagtccaaccccaggtgcccctgag
aaccagacctccctccacacccctgagacagagaagccatcgccccatctgcctccaact
cccacacctttggccatcaccaccactgtcacgatgggaggaaatgccacagttttgcag
gggttggactccagtactgaaactgagcagatgactccagagatggacgctactgaagag
agtgaaggaggtggcccgaccatgggccccgagttccgggcagcagaacagtctttacag
actgagttccagatctttcctggtgctggagaaaagggagcgaaaggagaacctgcgact
atagagcagggacagcagtttgagggacctgcaggagctccaggaccccggggaatatct
ggtccttcaggccctcctgggcctccgggcttccctggggaccgtggcctaccgggccct
gctggcctcccaggaatcccaggcattgatggcgtccggggcctgccaggcacagtgatc
atgatgccgttccattttgcaagcggctcgatgaaaggacccccagtctcctttcaacag
gcacaggcccaggcagtactgcaacaggctcagctgtccatgaaagggccccctggtcca
gtagggctcactgggcgcccaggccctgtgggcctccctggatatccaggtctgaaaggt
gaattgggagaagcagggcctcagggcccccgaggattgcagggccctcctgggcctcct
ggacgggaaggcaagacaggccgagctggagcagatggggctcggggtcttccgggagac
acaggacctaagggtgaccggggctttgatggcctgcctggactgcctggtgagaagggc
cagaggggtgactttggacctgtaggacaacctggtcccccaggagaagatggtataaag
ggcctgcagggacctccaggccccactggccaggctggagagccgggtccccgaggtctg
attggccccagaggcccccctggtcctttaggacgcccgggtgtgacagggagtgatggc
gcaccgggtgccaaaggcaacgtgggtcctcccggagaaccaggccccccaggacagcaa
ggaaaccacggctcccagggaatcccaggcccccaggggcccattggcacacccggggag
aagggtcctcctggaaaccccggaattccaggtgtcccaggatctgagggccccccgggc
cacccaggccatgagggtcccaccggagaaaagggggctcagggcccaccagggtcagca
ggccctcagggctatcctggacctcgtggtgtgaagggtacctctggtaaccggggcctc
caaggagagaaaggagaaaggggagaggatggttttccaggcttcaagggtgatgaggga
ccaaaaggcgaccggggaaacccgggactcccaggtcccagaggagaggatggcccagaa
ggacaaaaggggcctgagggactgcctggtgatgagggccccccaggagcagcaggggag
aagggcaagcttggggtgccaggtctcccaggttatccaggacgcccaggacctaaggga
tctattggatttcctgggccccttggaccactgggggagaaaggcaagcggggcaaagca
gggcagccaggggaggaaggagaacgtggcacaccgggcaccagaggagacagaggacag
ccaggggccacaggccagcctggccctaagggagatgtgggccagaacgggtctcctggg
gcccccggagaaaagggtctacccggtctgcaaggtcccccaggattccctgggccaaaa
ggccccccaggtcctcaggggaaagatgggatacccggacaccctggacaaagaggagaa
ttgggcttccaaggtcagacaggcccccctggaccagctggtgtccttggtcctcaggga
aaggtaggggatgtgggtcctctaggcgagagaggccccccagggcctcctggaccgcct
ggtgaaccaggtctgccaggcatagaaggcagagaaggggccaagggtgagctaggaccc
ctggggtccctcggaaaggaggggccacctgggcccatgggcttccctggcccacaagga
gcccccggagacccaggacccattggtttgaagggtgacaagggtcccccgggccctctt
ggggcaaatggctccccaggtgagcgtggtcctgtgggcccctctggaggcattgggctt
cctggccagagtggtgggcaaggccctattggtcctgctggtgagaaggggtccccggga
gaacggggtgtgcctggtcctactggcaaagatggtattccagggcccccgggacttcag
gggccccctggagctgcagggccttctggtgaggaaggagacaagggggaagtagggatg
cctggacacaagggaagcaaaggggataaaggagatgcgggcccacctggaccaacagga
ataaggggtccagcgggccatccaggccccccgggtgctgatggtgctcagggtcgccgg
ggaccccctggcctctttgggcagaaaggtgatgatggagtccgaggctttgtaggtgta
attggtcctccaggcctgcaggggctgccgggccctcctggggagaaaggcgaggttgga
gacgtgggatccatgggtccccacggagctccaggccctcggggtccccctgggcccagt
ggatcagcgggttccccagggctgcctggaggagtagggcagcctggcgctgtgggcgag
aagggtgagccagggaatgctggagacgctggacccccaggagttccaggcatccctggg
cccaaaggtgaaattggtgaaaagggggattcgggtccatcaggggctgctggtcctcca
ggcaaaaagggacctcctggagaggacggagctaaggggaacatgggtcccacaggactc
cctggagatctaggacccccaggagaccctggagttccgggtacggatggcatcccaggg
gagaaggggaatgctggtgatattgggggaccggggccacctggagcttcaggggaacct
ggtgcccgtgggctccctggcaagaggggttcccctggccgcatgggtccagaaggaaaa
gagggagagaaaggcgccaagggagatgctggtcccgatggccccccaggcagaacaggc
cccattggggctcgggggccccctggacgggttgggcctgatggtcttccagggatccct
ggtcctgtgggtgaaccaggtctcctgggacctcctgggctaatcggccctccagggccc
ctgggcccacctggcctccctggcctgaagggagacgctggcctcaagggggaaaagggc
cacattgggctaatcggcctcattggtcccccaggggaggctggggaaaaaggcgatcag
gggttgccaggtgtgcagggccctccaggccttcagggagaccctggtcttcctggtcct
gttggctccttaggtcaccctgggcccccaggtgtggtgggccctctgggacagaagggt
tccaaggggtccccgggatctcttggacctcgtggagaccctggaccagcaggtcctcct
ggtcccccgggttcccctgctgaggtgcacggcctgcgtaggcgccgctctgtgttggac
accccagaaggtggcctggaggaagtgatggcctcactcaattcactgagcttggagctg
gagcagttgcagcgacccccaggcacagccgagagcccaggcctcatatgccacgagctt
catcgaaaccacccacacctgccggacggagagtactggattgaccccaatcagggctgt
gcacgggacgccttcaaggtcttctgcaacttcactgccggaggtgagacctgtctctac
ccagacaagaagtttgagacggtgaaactggcctcctggtcccgagaaaagcctggaggt
tggtacagcaccttccgccgagggaagaagttctcctatgtggatgctgacggctccccg
gtgaatgtggtccagttgaccttcctgaagttgttgagcgctgcagcccatcagaggttc
acttacacctgccagaactccgcagcatggctggacgaagcttcaggtgaccacaggcac
tctatccgcttccaagggaccaactgggaagagttgtccttcaaccagacaacagcagcc
accatcaaggtcccccatgatggctgccgggtccggaagggacaggcgaagaccctcttt
gaattcagctcttctgtgggctttctgcctctgtgggatgtggccgccgttgactttggc
cagacgaaccagaagtttgggtttgaacttggctccgtctgctttagcagctga

DBGET integrated database retrieval system