KEGG   Rattus norvegicus (rat): 60465
Entry
60465             CDS       T01003                                 

Gene name
Cttn
Definition
(RefSeq) src substrate cortactin
  KO
K06106  cortactin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
rno05100  Bacterial invasion of epithelial cells
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    60465 (Cttn)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    60465 (Cttn)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    60465 (Cttn)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    60465 (Cttn)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    60465 (Cttn)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    60465 (Cttn)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    60465 (Cttn)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     60465 (Cttn)
SSDB
Motif
Pfam: HS1_rep SH3_9 SH3_1 SH3_2
Other DBs
NCBI-GeneID: 60465
NCBI-ProteinID: NP_068640
RGD: 619839
Ensembl: ENSRNOG00000047280 ENSRNOG00000050994
Vega: OTTRNOG00000002447
UniProt: Q66HL2
Position
1
AA seq 509 aa
MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRE
NVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRG
FGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQG
KTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQT
DRQDKCALGWDHQEKLQLHESQKDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKT
VPIEAVTSKTSNIRANFENLAKEREQEDRRKAEAERAQRMAQERQEQEEARRKLEEQARA
KKQTPPASPSPQPAEDRPPSSPIYEDAAPLKAEPSYGSSEPEPEYSTEAAGLPEASNQQG
LAYTSEPVYETTEVPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDVITN
IEMIDDGWWRGVCKGRYGLFPANYVELRQ
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgtggaaagcttctgcaggccatgctgtgtccatcacccaggatgatgggggagccgat
gactgggagactgaccctgattttgtgaacgatgtgagtgaaaaggaacagagatggggc
gccaaaaccgtgcagggatcggggcaccaggaacacatcaacatacacaagcttcgagag
aatgtcttccaagaacaccagacactcaaggagaaggagctggaaacgggacccaaggct
tcccatggctatggcgggaagtttggtgtggagcaagataggatggacaaatcagctgtg
ggccatgagtaccagtcaaagctctccaagcactgctcacaagtggactcagtccggggc
ttcggaggcaagttcggtgtccagatggacagggtggatcagtctgctgtaggctttgaa
taccaggggaagacggagaagcacgcctcccagaaagactactccagtggtttcggtggc
aaatatggagtgcaagctgaccgtgtagacaagagtgctgtgggctttgactaccagggc
aagacggagaagcacgagtcacagaaagattactccaaaggttttggtggcaaatacgga
attgacaaggacaaggtggataaaagcgctgtgggctttgagtatcaaggcaaaacagag
aagcatgagtcccagaaagactatgtaaaaggctttggaggaaagtttggtgtgcagaca
gacagacaggacaagtgtgcccttggctgggaccatcaggagaagctgcagctgcatgaa
tcccaaaaagactatgccaaaggattcggcgggaagtatggggtgcagaaggatcggatg
gacaagaacgcatccacctttgaagaagtggtccaggtgccgtctgcctatcagaagact
gtccccattgaggctgtgaccagcaaaaccagtaatattcgtgctaactttgaaaacctg
gcaaaggagagagagcaggaggacagacggaaggcagaagccgagagagctcagcggatg
gcccaagaaaggcaggagcaggaggaggctcgaaggaagctggaagagcaagccagagcc
aagaagcagacaccccctgcatcccctagtcctcagccagctgaagacagaccaccatcc
agccccatctatgaggatgcagctccgttgaaggccgagccgagctacggaagtagtgag
cctgagcctgagtacagcactgaggctgcaggccttcctgaggccagcaaccagcaaggt
ctggcctacacatcagagcctgtttacgagaccacagaggttcctggccactaccaagca
gaggatgacacctacgatgggtatgagagtgacctgggcatcacagccatcgccctgtat
gactaccaggctgctggcgatgatgaaatctcctttgaccctgatgatgtcatcaccaac
atagaaatgattgacgatggctggtggcgtggggtgtgcaagggcagatatgggctcttc
ccggccaactatgtggagctgcggcagtag

DBGET integrated database retrieval system