KEGG   Rattus norvegicus (rat): 60466
Entry
60466             CDS       T01003                                 

Gene name
Stx7
Definition
(RefSeq) syntaxin 7
  KO
K08488  syntaxin 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
rno04145  Phagosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    60466 (Stx7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    60466 (Stx7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    60466 (Stx7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    60466 (Stx7)
Membrane trafficking [BR:rno04131]
 SNARE
  Syntaxin (Qa)
   Stx-Endo
    60466 (Stx7)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   60466 (Stx7)
SSDB
Motif
Pfam: Syntaxin_2 SNARE Syntaxin Synaptobrevin DUF2976 CCDC-167 CD225 FUSC Prominin DUF4191 DUF3040 Orf78 T3SS_needle_E Cep57_CLD_2 Fusion_gly
Other DBs
NCBI-GeneID: 60466
NCBI-ProteinID: NP_068641
RGD: 619747
Ensembl: ENSRNOG00000015670
UniProt: O70257
Position
1p12
AA seq 261 aa
MSYTPGIGGDPAQLAQRISSNIQKITQCSAEIQRTLNQLGTPQDTPELRQQLQQEQQYTN
QLAKETDKYIKEFGFLPTTPSEQRQRKIQKDRLVAEFTTALTNFQKVQRQAAEREKEFVA
RVRASSRVSGGFPEDSSKEKNFVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEA
DIMDINEIFKDLGMMIHEQGDVIDSIEANVESAEVHVQQANQQLSRAANYQRKSRKTLCI
IILILVVGIVIIFFIVWGLKG
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtcttacactccggggattggtggggaccctgcccagctggcgcaacgcatctcctct
aacatccaaaagatcacacagtgctccgcggaaatacaaaggactctgaatcaactggga
acacctcaggatacaccggagttgaggcaacagctgcagcaggagcagcagtatactaac
caacttgcgaaagaaacagataagtacattaaggagtttggctttctgcccaccaccccc
agtgaacagcgtcaaaggaagatacagaaagaccgattggtggcagaattcaccacagcg
ctaacaaactttcagaaagtgcagaggcaagctgctgagagagagaaagagttcgtggcc
cgagtgcgagccagttccagagtatcgggtggctttcctgaagacagctcaaaagagaag
aattttgtatcttgggaaagccaaacacagcctcaagtgcaagtccaagatgaagaaatc
acagaggatgacctccggctcattcatgagagagagtcttcaatcagacagctggaagct
gacattatggacattaacgaaatattcaaagacttggggatgatgattcatgaacaagga
gatgttattgacagcatagaagccaatgtagaaagtgcggaagttcacgtacagcaggca
aaccagcagctgtcaagagcggcaaattatcagcgcaaatccagaaaaaccctctgcatc
atcattttaatcctggtggtcggaatcgtgatcatcttcttcatcgtatggggtctgaaa
ggctga

DBGET integrated database retrieval system