KEGG   Rattus norvegicus (rat): 60668
Entry
60668             CDS       T01003                                 

Gene name
Amph, Amph1
Definition
(RefSeq) amphiphysin
  KO
K12562  amphiphysin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    60668 (Amph)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    60668 (Amph)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    60668 (Amph)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    60668 (Amph)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    60668 (Amph)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    60668 (Amph)
SSDB
Motif
Pfam: BAR SH3_9 SH3_1 SH3_2 DUF3584 HD_3 THP2 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 60668
NCBI-ProteinID: NP_071553
RGD: 620274
Ensembl: ENSRNOG00000012490
UniProt: O08838
Position
17q11
AA seq 683 aa
MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQREL
RGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLT
LDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVF
EEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHAD
KAFSIQGAPSDSGPLRIAKTPSPPEEASPLPSPTASPNHTLAPASPAPVRPRSPSQTRKG
PPVPPLPKVTPTKELQQENIINFFEDNFVPEINVTTPSQNEVLEVKKEETLLDLDFDPFK
PDVTPAGSAAATHSPMSQTLPWDLWTTSTDLVQPASGGSFNDFTQPQDTSLFTMQTDQNM
AETEQALPTEPQAEEPPTTAAAPTAGLDLGLEMEEPKEEAAIPPGTDAGETVGTEGSTGE
EAEAEKAALPAGEGESPEGAKIDVESTELASSESPQAAELEAGAPQEKVIPSVVIEPASN
HEGEEHQETTTGTETREATEDVAPQGPAGEKQELATEPTPLDSQAATPAPAGAVDASLSA
GDAAQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESD
WLQYRDLATYKGLFPENFTRHLE
NT seq 2052 nt   +upstreamnt  +downstreamnt
atggccgacatcaagacgggcatcttcgccaaaaacgtgcaaaagcggctcaaccgggca
caggaaaaggtcctccagaagctgggaaaggcagatgaaacaaaagatgaacagtttgaa
gaatatgttcagaacttcaagcggcaagaggcagagggtaccagacttcagcgagaactg
cgaggatatttagcggcaatcaaaggtatgcaggaggcctcaatgaagcttaccgagtca
ctacatgaagtctacgagccagattggtatggacgggaagatgtaaagatggttggtgag
aagtgtgatgtgctgtgggaagacttccatcaaaagctagtggatgggtccttgctgaca
ctggacacgtacctgggccagtttcctgacataaagaatcgcatcgctaagcgcagcagg
aagctcgtggattacgacagtgcccgccatcacctggaggctctgcagagttccaaaagg
aaggatgagagtcggatctctaaggcagaagaggagtttcagaaagcacagaaagtgttt
gaagagttcaatgttgacttacaagaagaattgccatcactatggtcaagacgagttggg
ttttatgtcaatactttcaaaaacgtctctagccttgaggccaagtttcacaaggaaatc
gcagtgctttgccacaagctttatgaagtgatgacgaaacttggtgatcagcacgctgac
aaggccttcagcattcaaggagctcccagtgattcgggtcctcttcgcattgcaaagaca
ccatcacccccagaggaggcttcacccctccccagcccaacggctagtcccaaccacaca
ttagcacctgcatctcctgccccagtgcgacccagatcaccttcacagacaaggaaaggg
cctcctgtcccacctctgcctaaagtcaccccaacaaaggaactacagcaggagaacatc
atcaatttctttgaggacaactttgtaccagaaatcaatgtgacaacaccttcccagaat
gaagtcctggaggtgaagaaggaggagactttgctggatttggactttgaccctttcaaa
cctgatgtgaccccagcaggttctgctgcagcgacccactcacccatgtctcagacattg
ccctgggacttatggacgacaagcactgatttggtacaaccggcttctggaggttcgttt
aatgattttacccagccccaggatacttcattattcacgatgcagacagatcagaatatg
gctgaaactgagcaggctctacctacagagccccaggcagaggagcctcccaccactgct
gctgcacctactgctgggctggaccttgggctagagatggaggagccaaaggaggaggca
gcgatccctcctggaactgatgctggtgagactgtgggaactgaggggtccacaggggag
gaagcagaggcagagaaggcagccctacctgctggagaaggcgaaagtcctgagggagcc
aaaatcgatgtggaaagcactgagcttgcaagcagtgagagccctcaagcagcagagctt
gaagctggtgctcctcaggaaaaggtcatcccttctgttgtcatagagccagcctccaac
catgaaggagaagaacaccaagaaaccactacgggtactgaaacaagggaggccactgag
gacgtggctccccagggcccagccggtgagaagcaggaactggctacagagcccacgcct
ctggattctcaggctgctacgcctgcaccagcaggtgctgtggatgcttcgctgtctgca
ggggatgccgctcaggaactgcctcctggctttctctacaaggtggaaactctgcatgac
ttcgaggcagcgaactctgatgaacttaccctacaaaggggtgatgtggtgctcgtggtg
ccctcagactcagaagccgaccaggatgcaggctggttggtgggggtgaaggagtcagac
tggcttcagtacagagacctggccacatacaaaggcctctttccagagaacttcacacga
cacctagaatag

DBGET integrated database retrieval system