KEGG   Rattus norvegicus (rat): 64027Help
Entry
64027             CDS       T01003                                 

Gene name
Bspry
Definition
(RefSeq) B-box and SPRY domain containing
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PRY SPRY zf-B_box Trypan_PARP Lys-AminoMut_A Vac_Fusion
Motif
Other DBs
NCBI-GeneID: 64027
NCBI-ProteinID: NP_071597
RGD: 708400
Ensembl: ENSRNOG00000015105
UniProt: Q6P6S3 B2GVA0
Position
5q24
AA seq 448 aa AA seqDB search
MSSDVSGTESGSESGPESVPEPVPEPGPEPESEPGPGPAPGPGPGPAPGPGPGLGREPGQ
RYQPCQLCPEHGKPLSWFCLSERRPVCATCAGFGGRCHRHRIRRAEEHAEELRNKIVDHC
EKLQLQSAGITKYVAEVLQGKNQKAMIMANATREVIIQRLSLVRCLCESEEQRLLEQVHS
EEERAHQCILTQRAHWDDKLRKLDSLRTSMVDMLTHLNDLQLIQMEQEILERAEEAEGIL
EPQESEKLSFNEKCAWSPLLTQLWATSVLGSLSGMEDVLIDERTVGPLLNLSEDRKTLTF
NAKKSKVCSDDPERFDHWPNALAVNAFQTGLHAWAVNVKHSCAYKVGVASAQLPRKGSGS
DCRLGHNAFSWVFSRYDQEFCFSHNGNHEPLALLRCPTQLGLLLDLQAGELIFYEPASGT
VLHIHRESFPHRLFPVFAVADQVISIVC
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcggatgtctccgggacggagtccgggtccgagtccgggccggagtcggttccg
gagccggtgccggagcccgggccggagccggagtcggagccggggccggggccggcgccc
gggccggggccggggccggcgccggggccgggacccggactggggcgggaacccgggcag
aggtaccagccatgccagttgtgccccgagcacgggaagcctctgagctggttctgcctc
tcggagcgacgaccggtatgcgccacctgcgccgggtttggcggccgatgtcaccggcac
cgcatccgccgagcggaggagcacgctgaggagctgagaaacaagattgtggaccactgt
gagaagctgcagttacagagtgctggcatcaccaagtatgtggccgaggtcctgcagggg
aagaaccagaaagcaatgatcatggctaatgcaacgagggaagtgatcatccagaggttg
agtctggtgaggtgcctgtgtgagagtgaggaacagcgattactggagcaggtgcacagc
gaagaggagcgggcccaccagtgcatcctgactcagagggcacactgggatgacaaactc
cggaaactggactccctccgcaccagcatggtggacatgctcacccatctgaatgacctc
cagctgattcagatggagcaggagattcttgagagggccgaggaagcagagggcattttg
gagccccaggagtcggagaaattaagctttaatgagaagtgtgcttggagccctctactg
actcaactgtgggcaacatcggttctcgggtctctctcaggcatggaggatgtgcttatt
gatgaaaggactgtcggccccttattgaatttgtccgaagatcgaaagaccctgaccttc
aatgccaagaagtccaaggtctgctcagatgacccagagcgctttgaccactggcccaat
gccctggctgtcaatgccttccagactgggctccatgcctgggcagtgaatgttaaacac
agctgtgcttacaaagtgggtgtggcctcagctcagctgccccgaaagggttctggcagt
gactgccgcctgggccacaatgccttctcctgggtcttctcccgctatgatcaagagttc
tgtttctcacacaacgggaaccatgaacctctggcgctcctccggtgcccaacacagctg
ggcctgctgttggacctgcaggcaggagagctgatcttctacgagcctgcctcagggaca
gtgcttcacatccaccgtgagtccttcccgcacaggctcttcccagtctttgctgtggcc
gaccaggtcatctccatcgtttgctga

DBGET integrated database retrieval system