KEGG   Rattus norvegicus (rat): 64033
Entry
64033             CDS       T01003                                 

Gene name
Ccnd2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04340  Hedgehog signaling pathway
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04630  JAK-STAT signaling pathway
rno04917  Prolactin signaling pathway
rno05162  Measles
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    64033 (Ccnd2)
   04340 Hedgehog signaling pathway
    64033 (Ccnd2)
   04390 Hippo signaling pathway
    64033 (Ccnd2)
   04630 JAK-STAT signaling pathway
    64033 (Ccnd2)
   04068 FoxO signaling pathway
    64033 (Ccnd2)
   04151 PI3K-Akt signaling pathway
    64033 (Ccnd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    64033 (Ccnd2)
   04115 p53 signaling pathway
    64033 (Ccnd2)
   04218 Cellular senescence
    64033 (Ccnd2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    64033 (Ccnd2)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    64033 (Ccnd2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64033 (Ccnd2)
   05202 Transcriptional misregulation in cancer
    64033 (Ccnd2)
   05206 MicroRNAs in cancer
    64033 (Ccnd2)
   05203 Viral carcinogenesis
    64033 (Ccnd2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    64033 (Ccnd2)
   05162 Measles
    64033 (Ccnd2)
   05169 Epstein-Barr virus infection
    64033 (Ccnd2)
   05165 Human papillomavirus infection
    64033 (Ccnd2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 64033
NCBI-ProteinID: NP_071603
RGD: 621083
Ensembl: ENSRNOG00000057710
UniProt: Q04827
Position
4
AA seq 288 aa
MELLCCEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVAT
WMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAE
KLCIYTDNSVKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQKEKLSLIRKHA
QTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVNALTCDALTELLAKITHTDVD
CLKACQEQIEAVLLNSLQQFRQEQHNGSKSVEDPDQATTPTDVRDVDL
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgtgaggtggacccggtccgcagggccgtgccggaccgcaacctg
ctggaagaccgcgtcctgcagaacctgttgactatcgaggagcgctacctcccgcagtgt
tcctatttcaagtgcgtgcagaaggacatccagccgtacatgcgcaggatggtggctacc
tggatgctagaggtctgtgaggaacagaagtgtgaagaagaggtctttcctctggccatg
aattacctggaccgtttcttggctggagtcccgactcctaagacccatctccagctcctg
ggcgctgtgtgcatgttcctagcttccaagctgaaagagaccatcccgctgactgccgaa
aagctgtgtatttacaccgacaattctgtgaaaccccaggagctgctggagtgggaactg
gtggtgctgggtaagctgaagtggaacctggctgcagtaacccctcacgacttcattgag
cacatcctacgcaagctgccccagcagaaggagaagctgtccctgatccgcaagcatgcg
cagaccttcatcgctctgtgtgctaccgacttcaagtttgccatgtacccgccatcgatg
atcgcaactggaagcgtgggagcagccatctgcgggcttcagcaggacgaggaagtgaat
gcactcacgtgcgatgccctgacggagctgctggccaagatcacccacaccgatgtggat
tgtctcaaagcctgccaggagcaaatcgaggctgtgctgcttaacagccttcagcagttc
cgtcaagagcagcacaacggctccaagtctgtggaagatccggaccaagccaccacccct
acagacgtgcgggatgttgacctgtga

DBGET integrated database retrieval system