KEGG   Rattus norvegicus (rat): 64157
Entry
64157             CDS       T01003                                 

Gene name
Ddah1
Definition
(RefSeq) N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
  KO
K01482  dimethylargininase [EC:3.5.3.18]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64157 (Ddah1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.18  dimethylargininase
     64157 (Ddah1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   64157 (Ddah1)
SSDB
Motif
Pfam: Amidinotransf
Other DBs
NCBI-GeneID: 64157
NCBI-ProteinID: NP_071633
RGD: 70968
Ensembl: ENSRNOG00000014613
UniProt: O08557
Position
2
AA seq 285 aa
MAGLSHPSVFGRATHAVVRAPPESLCRHALRRSQGEEVDFARAERQHQLYVGVLGSKLGL
QVVQLPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMK
DENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADSLHLKSFCSM
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDMAANCIYLNIPSKGHVLLHRTPE
EYPESAKVYEKLKDHLLIPVSNSEMEKVDGLLTCCSVFINKKTDS
NT seq 858 nt   +upstreamnt  +downstreamnt
atggccggcctcagccacccctcggtcttcggccgggccacccacgccgtggtgcgggct
ccgcccgagtccctgtgccgccacgcgctgaggcgctcccagggcgaagaggtggatttc
gctcgcgctgagcgccagcaccagctctacgtgggcgtgctgggcagcaagctggggctg
caggtggtgcagctgccggccgacgagagcctgcctgactgcgtgttcgtggaggacgtg
gccgtggtgtgcgaggagaccgccctcatcacccgccccggggcgcctagccgcaggaag
gaggttgacatgatgaaagaggctttggaaaaacttcagctcaacatagtagagatgaaa
gatgaaaatgcaaccttagatggtggggacgtcctattcacaggcagagagttttttgtg
ggcctttccaaaaggacaaatcaacgaggtgctgagatcttggctgatactttcaaggac
tacgcagtttccacagtccccgtggccgattctttgcatttaaagagtttctgcagcatg
gctggccccaacctgatcgcaatagggtccagtgaatctgcgcagaaggccctcaagatc
atgcaacagatgagtgaccaccgttatgacaagctcactgtaccggacgacatggccgcc
aactgtatatatttaaatatccccagcaaagggcatgtcttgctgcaccgaaccccagaa
gagtacccagaaagcgcaaaggtttatgagaagctcaaggaccatctactgatccctgtg
agcaattctgagatggaaaaggtggacggcttgctcacctgctgctccgtttttattaac
aagaagacagactcttga

DBGET integrated database retrieval system