KEGG   Rattus norvegicus (rat): 64171Help
Entry
64171             CDS       T01003                                 

Gene name
Card9
Definition
(RefSeq) caspase recruitment domain family, member 9
  KO
K12794  caspase recruitment domain-containing protein 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    64171 (Card9)
   04625 C-type lectin receptor signaling pathway
    64171 (Card9)
 09160 Human Diseases
  09167 Infectious diseases
   05152 Tuberculosis
    64171 (Card9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD CARD_2 FXR_C1 NMO
Motif
Other DBs
NCBI-GeneID: 64171
NCBI-ProteinID: NP_071639
RGD: 708370
Ensembl: ENSRNOG00000051470
UniProt: Q9EPY0
Position
3p13
AA seq 536 aa AA seqDB search
MSDYENDDECWSALESFRVKLISVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRK
VGVLLDILQRTGHKGYVAFLESLELYYPQLYRKVTGKEPARVFSMIIDASGESGLTQLLM
TEVMKLQKKVQDLTALLSSKDDFIKELRVKDSLLRKHQERVQRLKEECELSSAELKRCKD
ENYDLAMRLAHLSEEKGAALMRNRDLQLEVDQLRHSLMKAEDDCKVERKHTLKLRHAMEQ
RPSQELLWDLQQERDLLQARVQELEVSVQEGKLHRNSPYIQVLEEDWRQALQEHQEQAST
IFSLRKDLRQAEALRTRCMEEKEMFELQCLALRKDAKMYKDRIEAILQQMEEVSIERDQA
MTSREELHAQCAQSFQDKDKLRKQVRELDEKADELQLQLFQTESRLLAAEGRLKQQQLDM
LILSSDLEDSSPRNSQELSLPQDLEEDAQLSDKGVLADRESPEQPFVVLNKKHLSQTHDT
VPSSSEPPEKERRRLKESFENYRRKRALRKMQNSWRQGEGDHGNTTGSDNTDTEGS
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcagactatgaaaatgacgacgagtgctggagtgccctggagagcttccgggtgaag
ctaatctctgtcattgacccctcacgaatcacaccctatctgcgccagtgcaaagtcctg
aaccccgatgatgaggagcaggtgctcagtgaccccaacctggtcatccgcaagcggaaa
gtgggtgtgctcctggacatcctgcagcggacaggccacaagggctacgtggcctttctt
gagagtctggaactctactaccctcagttatacaggaaagtcactggcaaggagccagcg
cgtgtcttctccatgatcatcgacgcatcaggggagtcgggcctgacgcagctgctgatg
acagaggtcatgaagctgcagaagaaggttcaggacctgacggcccttctgagctccaag
gatgacttcatcaaggagctgagggtaaaggacagcctcctgcgcaagcaccaggagcgg
gtgcagcggctcaaggaggagtgtgagctgagcagtgccgagctgaagcgctgcaaggat
gagaactacgacctggccatgcgcctggctcacctgagtgaagagaagggagcagcactc
atgcggaaccgtgacctgcagcttgaggtggaccagctcaggcacagcctcatgaaggca
gaggatgactgcaaggtggagcgcaaacacacactgaagctccggcacgccatggagcag
cggcctagccaggagctgctgtgggacctgcagcaggagagggacttgttgcaggcccgg
gtgcaggagctggaggtctccgtgcaggagggtaagctacacaggaatagcccatacatc
caggtgctggaggaggactggcgtcaggcactgcaggaacaccaggagcaggccagcacc
atcttctccctacgaaaggacctccgccaggctgaggccctccggacccggtgcatggag
gaaaaggagatgttcgagctgcagtgcctggccttgcgcaaggatgccaagatgtacaag
gaccggatcgaggctatcctgcagcagatggaggaagtctccattgagcgggaccaggct
atgacctcaagggaagagctgcatgcacagtgtgcccaaagctttcaggacaaagataag
ctgcgaaagcaggttcgagaactggatgagaaggccgacgagttgcagctgcagctgttc
cagaccgagagccgattactggccgctgagggcagactcaagcagcagcaattggacatg
ctcatcctgagctctgacttggaagacagttcccccaggaactcccaggagctttcactg
cctcaggacctggaggaggatgcccagctctcagacaaaggtgtcctggcagacagggag
agcccagagcagcccttcgtggttctgaacaagaagcatctttcgcagacccatgacacg
gtgcccagcagcagcgagcccccggagaaggagcggcggcgcctcaaggagagcttcgag
aactaccgcaggaagcgggcgctccgcaagatgcagaacagctggcgacagggagaaggg
gatcacgggaatacgacaggcagcgacaacaccgacaccgagggctcctag

DBGET integrated database retrieval system