KEGG   Rattus norvegicus (rat): 64191
Entry
64191             CDS       T01003                                 

Gene name
Dhcr7
Definition
(RefSeq) 7-dehydrocholesterol reductase
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00100  Steroid biosynthesis
rno01100  Metabolic pathways
Module
rno_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    64191 (Dhcr7)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     64191 (Dhcr7)
SSDB
Motif
Pfam: ERG4_ERG24 Orf78 Tudor_4 HKR_ArcB_TM
Other DBs
NCBI-GeneID: 64191
NCBI-ProteinID: NP_071784
RGD: 621769
Ensembl: ENSRNOG00000020776
UniProt: Q9Z2Z8
Position
1q42
AA seq 471 aa
MASKSQHNASKAKNHNVKAESQGQWGRAWEVDWFSLVSVIFLLLFAPFIVYYFIMACDQY
SCSLTAPILDVATGRASLADIWAKTPPVTAKAAQLYALWVSFQVLLYSWLPDFCHRFLPG
YVGGVQEGAITPAGIVNKYEVNGLQAWLITHFLWFVNAYLLSWFSPTIIFDNWIPLLWCA
NILGYAVSTFAMIKGYLFPTSAEDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFNGRPG
IVAWTLINLSFAAKQQELYGHVTNSMILVNVLQAIYVLDFFWNETWYLKTIDICHDHFGW
YLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPNALGVLLLGLVGYYIFRMTNHQKDLFRRT
DGHCLIWGKKPKAIECSYTSADGLKHRSKLLVSGFWGVARHFNYTGDLMGSLAYCLACGG
GHLLPYFYIIYMTILLTHRCLRDEHRCANKYGRDWERYVAAVPYRLLPGIF
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggcttcaaagtcccagcacaacgcttccaaagccaagaatcacaacgtcaaggctgaa
tctcaaggacaatggggccgtgcctgggaagtggactggttctccctggtcagcgtcatt
ttcctgctgctcttcgcaccgttcattgtgtactacttcatcatggcatgtgaccagtac
agctgctcgctgactgcccccatattggacgtagctacaggccgtgcgagtctggcagac
atctgggccaagacaccgcctgtgacagctaaggctgcccaactgtatgccttgtgggtc
agcttccaggtgctgctttactcctggcttcctgacttctgccacagatttctgccaggt
tatgtgggaggcgtccaagaaggtgccataactccagcagggattgtaaataagtatgag
gtgaatgggctgcaagcctggctcattacccacttcctctggtttgtgaacgcttacctc
ctatcctggttctcccccaccatcatctttgacaactggatcccgttgctatggtgtgcc
aacatcctgggctacgctgtgtccacctttgcaatgatcaaggggtacctgttccccacc
agcgccgaagactgcaaattcacaggcaatttcttctacaactacatgatggggattgag
ttcaacccccgcatcggaaagtggtttgacttcaagctgttcttcaatgggcgcccgggg
attgtggcctggactcttatcaacctgtcctttgctgccaagcagcaggagctttatggc
catgtgaccaactccatgattttggtcaatgtcttacaggccatctatgtgttagacttc
ttctggaacgaaacctggtacctgaagaccattgacatctgccatgaccactttggatgg
tacctgggctggggagattgcgtgtggctgccctacctctacacactgcagggcctgtac
ttggtgtaccaccctgtacagctctccacccccaacgccttgggcgtcctgctgctcggc
ctggtgggttactatatcttccgaatgaccaaccatcagaaggacctgttccgccggaca
gatggacactgcctcatctggggcaagaaacccaaggccatcgagtgctcctacacgtca
gccgacgggctgaagcaccgcagcaagctgttggtttcaggcttctggggtgtggcccgc
cacttcaactataccggagacctgatgggcagcctcgcctactgcctggcttgtggcggc
ggccacctcctcccctacttctacatcatctatatgactatcctgcttacccaccgctgc
ctccgtgatgagcaccgctgtgccaacaagtatggccgtgactgggagcgctacgtagcc
gctgtgccctaccgcctgctgcctgggatcttctga

DBGET integrated database retrieval system