KEGG   Rattus norvegicus (rat): 64205Help
Entry
64205             CDS       T01003                                 

Gene name
Rplp0, Arbp
Definition
(RefSeq) ribosomal protein lateral stalk subunit P0
  KO
K02941  large subunit ribosomal protein LP0
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    64205 (Rplp0)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    64205 (Rplp0)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    64205 (Rplp0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RL10P_insert Ribosomal_L10 Ribosomal_60s
Motif
Other DBs
NCBI-GeneID: 64205
NCBI-ProteinID: NP_071797
RGD: 621247
Ensembl: ENSRNOG00000001148
UniProt: P19945
Position
12q16
AA seq 317 aa AA seqDB search
MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTM
MRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCE
VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI
SPFSFGLIIQQVFDNGSIYSPEVLDITEQALHTRFLEGVRNVASVCLQIGYPTVASVPHS
IINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFAAAAPVAAATTAAPAAAAAPAKVEA
KEESEESDEDMGFGLFD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcccagggaagacagggcgacctggaagtccaactacttccttaagatcatccaactt
ttggatgactacccaaaatgcttcattgtgggagcagacaatgtgggctccaagcagatg
cagcagatccgcatgtccctccgcgggaaggctgtggtgctgatgggcaagaacaccatg
atgcgcaaggccatccggggccacctggagaacaaccccgctctggagaagctgctgcct
cacatccgggggaacgtgggctttgtgttcaccaaggaggacctcaccgagattagggac
atgctgctggccaataaggtgccagctgctgcccgagccggtgccatcgccccgtgtgag
gtcacagtacctgctcagaacaccggtctggggcccgagaagacctctttcttccaagct
ttgggcatcaccactaaaatctccagaggtaccattgaaatcctgagcgatgtgcagctg
ataaagactggagacaaggtgggagccagcgaagccacactgctgaacatgttgaacatc
tcccccttctccttcgggctgatcatccagcaggtgtttgacaatggcagcatctacagc
ccagaggtgctggacatcacagagcaggccctgcacactcgcttcctagagggtgtccgc
aatgtggccagcgtctgtctgcagattggctacccgactgttgcctcagtgcctcactcc
atcatcaatggatacaaaagggtcctggctttgtctgtggagactgactacaccttccca
ctggctgaaaaggtcaaggccttcctggccgatccatctgcatttgcggctgcggcccct
gtggctgctgccaccactgctgctcctgcagctgctgctgccccagccaaggtcgaagca
aaggaagagtcggaggaatccgatgaggacatgggattcggtctcttcgactaa

DBGET integrated database retrieval system