KEGG   Rattus norvegicus (rat): 64300
Entry
64300             CDS       T01003                                 

Gene name
Mthfd1
Definition
(RefSeq) methylenetetrahydrofolate dehydrogenase, cyclohydrolase and formyltetrahydrofolate synthetase 1
  KO
K00288  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase / formyltetrahydrofolate synthetase [EC:1.5.1.5 3.5.4.9 6.3.4.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00670  One carbon pool by folate
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00141  C1-unit interconversion, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    64300 (Mthfd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64300 (Mthfd1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     64300 (Mthfd1)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     64300 (Mthfd1)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     64300 (Mthfd1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   64300 (Mthfd1)
SSDB
Motif
Pfam: FTHFS THF_DHG_CYH_C THF_DHG_CYH AP_endonuc_2
Other DBs
NCBI-GeneID: 64300
NCBI-ProteinID: NP_071953
RGD: 708531
Ensembl: ENSRNOG00000005602
UniProt: P27653
Position
6q24
AA seq 935 aa
MAPAGILNGKVVSAQIRNRLKTQVTQMQEQVPGFTPGLAILQVGDRDDSNLYINVKLKAA
QEIGIKATHIKLPRTSTESEVLKYVISLNEDATVHGFIVQLPLDSENSINTEAVINAIAP
EKDVDGLTSINAGKLARGDLKDCFIPCTPKGCLELIKETGVQIAGRHAVVVGRSKIVGAP
MHDLLLWNNATVTTCHSKTADLDKEVNKGDILVVATGQPEMVKGEWIKPGAVVIDCGINY
VPDDTKPNGRKVVGDVAYDEAKEKASFITPVPGGVGPMTVAMLMQSTVESAQRFLKKFKP
GKWTIQYNKLNLKTPVPSDIAISRSCKPKLIGNLAREIGLLTEEVELYGETKAKVLLSAL
DRLKHQPDGKYVVVTGITPTPLGEGKSTTTIGLVQALGAHLHQNVFACVRQPSQGPTFGI
KGGAAGGGYSQVIPMEEFNLHLTGDIHAITAANNLVAAAIDARIFHELTQTDKALFNRLV
PSVNGVRKFSDIQIRRLRRLGIEKTDPAALTDDEINRFARLDIDPETITWQRVLDTNDRF
LRKITIGQAPTEKGHTRTAQFDISVASEIMAVLALTSSLEDMRARLGKMVVASSKKGEPI
SCEDLGVSGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSIIADRIALKLVG
PEGFVVTEAGFGADIGMEKFFNIKCRYSGLQPHVVVLVATVRALKMHGGGPTVTAGLPLP
KAYTEEDLDLVEKGFSNLRKQIENARMFGVPVVVAMNAFKTDTDTELDLIGRLSREHGAF
DAVKCTHWAEGGQGALALAQAVQRASQAPSSFQLLYDLKLSVEDKIRIIAQKIYGADDIE
LLPEAQNKAEIYTKQGFGNLPICMAKTHLSLSHNPEQKGVPTGFVLPIRDIRASVGAGFL
YPLVGTMSTMPGLPTRPCFYDIDLDPETEQVNGLF
NT seq 2808 nt   +upstreamnt  +downstreamnt
atggcaccagcgggaatcctgaacgggaaagtggtctccgcgcaaatcaggaatcgactg
aagacccaggttactcagatgcaggagcaggtacctggcttcacccctggcctggcaatc
ctgcaggttggcgacagagatgattccaatctttatataaatgtgaagctgaaggctgct
caagagatcgggatcaaagccactcacattaaattaccaagaacttccacagagtcggag
gtgttaaaatacgtcatctccctgaatgaggatgccactgtgcacggattcatagtacag
ctgcctttagactccgagaattccattaacacagaggcagtcatcaatgccattgcccct
gagaaggatgtggacgggttgacgagcatcaatgccgggaagcttgccagaggtgatcta
aaggactgcttcattccgtgcacacccaaaggatgcttggaactcatcaaagagacagga
gtgcagattgcaggaaggcacgccgtggtggtcgggcgaagtaaaatagttggtgcaccc
atgcacgacctgcttctgtggaacaatgccacggtgaccacctgccactccaagactgcc
gatctggacaaggaggtaaataaaggagacattctggtggttgcaacaggacagcctgag
atggtgaaaggggagtggatcaagcctggagctgtggtcatagactgtgggatcaattat
gttccagatgatacaaaaccaaatggaaggaaagttgtgggtgacgtagcatatgacgag
gccaaggagaaggcgagctttatcacgcctgtccccggtggcgtggggcccatgaccgtg
gcaatgctgatgcagagcacagtagagagcgcacagcgcttcctgaagaaatttaagcca
gggaagtggacaattcagtataacaagctgaacctcaagacgcctgtaccaagtgacatt
gctatatcacgatcttgcaaacccaagctcatcggtaacctggcccgagaaattgggcta
ctcactgaggaggtggaattgtatggagaaacaaaggccaaggtcttactgtcagcacta
gatcgcctgaagcatcagccagatgggaaatacgttgtggtgactggaattactccaaca
cccctgggagaagggaagagcacaaccaccatcgggcttgtgcaagcccttggcgcccac
ctgcatcagaatgtttttgcgtgtgtgcgacagccttctcagggccccacctttgggata
aaaggtggcgctgcaggaggcggctattcccaggtcattcctatggaagagtttaatctc
cacctcactggtgacatccacgccatcactgccgctaataaccttgtggctgctgctatt
gacgctcggatatttcatgagctgacccagacagacaaggctctctttaatcgtctggta
ccctcagtaaatggagtaagaaagttctctgacatccaaatccgcaggttacggaggcta
ggcattgagaagactgaccccgctgcgctgacagatgatgagataaacagatttgcaaga
ctagatattgatccagaaaccataacatggcagagagtgctggatactaacgatagattc
ctgaggaagatcaccattggacaggctccaaccgagaaaggccacacacgcacggcccag
tttgatatctctgtggccagtgaaatcatggcagtcctggccctcactagttctctggaa
gacatgagagcaaggctgggcaaaatggtggtagcgtccagtaagaaaggggagcctatc
agctgtgaagacctgggcgtgagcggggcgctgacggtgctcatgaaggatgcgatcaag
cccaatctcatgcagaccttagagggcacgccggtatttgtccatgctgggccttttgcc
aacattgcacatgggaattcctccatcattgcagaccggattgcactcaagctggttggc
cctgagggctttgtagtgacagaagcaggattcggagcagacataggaatggaaaagttc
ttcaacatcaagtgccggtattctggtctccagcctcatgtggtggttcttgttgccact
gtcagggctcttaagatgcacgggggtggccccacggtcaccgctggactgcctcttccc
aaggcttacacagaagaggacctggacctggtggaaaagggcttcagtaacttgaggaaa
cagatagaaaatgctagaatgtttggagtgcctgtcgtggtggccatgaatgcattcaag
acagatacagatactgagctggacctcatcggccgcctctccagagagcatggggctttc
gatgctgtcaagtgcacccactgggcagaagggggccagggagccttagccctggctcag
gctgtccagagagcttcacaggcccccagcagcttccagctcctctatgacctcaagctc
tcagttgaagataaaatcaggattattgcacagaagatctacggggccgatgacatcgaa
ttgctccctgaagcacaaaacaaagcagaaatctacacaaagcagggctttgggaatcta
cccatctgcatggccaaaacacacttgtctttatctcacaacccagagcaaaaaggggtg
cctactggcttcgttctgcccatccgggacatccgggccagcgttggggctggtttcctg
taccctttagtaggaacgatgagcacaatgcctggactccctactcgaccctgtttttat
gatatcgatttggaccctgaaactgaacaagtgaatggattgttttaa

DBGET integrated database retrieval system