KEGG   Rattus norvegicus (rat): 64512Help
Entry
64512             CDS       T01003                                 

Gene name
Fzd2, Fz-10, Fzd10
Definition
(RefSeq) frizzled class receptor 2
  KO
K02235  frizzled 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    64512 (Fzd2)
   04390 Hippo signaling pathway
    64512 (Fzd2)
   04150 mTOR signaling pathway
    64512 (Fzd2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    64512 (Fzd2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    64512 (Fzd2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64512 (Fzd2)
   05205 Proteoglycans in cancer
    64512 (Fzd2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    64512 (Fzd2)
   05226 Gastric cancer
    64512 (Fzd2)
   05217 Basal cell carcinoma
    64512 (Fzd2)
   05224 Breast cancer
    64512 (Fzd2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    64512 (Fzd2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    64512 (Fzd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    64512 (Fzd2)
G protein-coupled receptors [BR:rno04030]
 Frizzled / Smoothened family
  64512 (Fzd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz
Motif
Other DBs
NCBI-GeneID: 64512
NCBI-ProteinID: NP_742032
RGD: 71012
Ensembl: ENSRNOG00000021962
UniProt: Q08464
Position
10q32.1
AA seq 570 aa AA seqDB search
MRARSALPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQT
IMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICE
RARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGTPALLTTAPPSGLQPG
AGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMF
FSHHHTRFARLWILTWSVLCCASTFFTVTTSLVAMQRFRYPERPIIFLSGCYTMVSVAYI
AGFVLQERVVCNERFSEDGYRTVGQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLA
AGMKWGHAAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNRLDPLRGF
VLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEPLERLMVRIGVFSVLYTVPATI
VIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRTSPDFTVYMIKYLMTLIVGITS
GFWIWSGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcccgcagcgccctgccccgcagcgccctgccccgcctgctgctgccactgctg
ctgctgccggctgccgggccggctcagttccacggggagaagggcatctccatcccggac
cacggcttctgccagcccatctccatcccgctgtgcacggacatcgcctacaaccagacc
atcatgcccaaccttcttgggcacacgaaccaagaggacgcgggcctggaggtgcatcaa
ttctacccgctggtgaaggtgcagtgctcgcccgagctgcgcttcttcctgtgctccatg
tacgctccggtgtgcacggtgctggagcaggccatcccgccgtgccgctccatctgcgaa
cgcgcgcgccaaggctgcgaggcgctcatgaacaagttcggcttccagtggcccgagcgc
ctccgctgcgagcatttcccgcgtcacggcgcggagcagatctgcgtgggccagaaccac
tccgaggacggaactcctgcgctactcaccaccgcgccaccgtctgggctgcagcctggc
gctggtggcaccccgggcggccctggcggtggtggcgcgcccccgcgctacgccactctg
gagcaccctttccactgtccccgcgtcctcaaggtgccgtcctatctcagctataagttt
ctgggtgagcgcgattgtgccgcgccctgcgagcctgcacggcccgacggctccatgttc
ttctcgcaccaccacactcgttttgcccgtctctggatcctcacatggtcggtgctgtgc
tgcgcttctactttcttcacggtcaccacctctttagtggccatgcagcgattccgctac
ccagagcggcccatcatcttcctgtccggttgctacaccatggtgtcagtggcctacatt
gcgggcttcgtgctccaggagcgcgtggtgtgcaacgagcgcttctctgaggacggttat
cgcacggtggggcagggcactaagaaagaaggctgtactatactcttcatgatgctctac
ttcttcagtatggccagctccatctggtgggtgattctgtccctcacctggttcctggca
gccggtatgaagtggggccacgcggccatcgaggccaattcgcagtacttccacctggcc
gcctgggcggtgccggccgtcaaaaccatcaccatcctggccatgggccagatcgacggc
gacctgctgagcggcgtgtgcttcgtgggcctcaacaggctggacccgctgcgaggcttc
gtgctggcgccgctcttcgtgtacctgttcatcggcacatccttcctgctggcgggcttc
gtgtcactcttccgcatccgcaccatcatgaagcacgacggcaccaagacggagccgctg
gagaggctcatggtgcgtatcggcgtcttctccgtgctctacaccgtaccggccaccatc
gtcatcgcctgctacttctatgagcaggccttccgcgagcactgggagcgctcgtgggta
agccagcactgcaagagcctagccatcccctgcccggcccactacacgccccgcacgtcg
cccgacttcacagtctacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcg
ggcttctggatctggtccggcaagacgctgcactcgtggaggaagttctacacgcgtctc
accaacagccggcatggagagaccaccgtgtga

DBGET integrated database retrieval system