KEGG   Rattus norvegicus (rat): 65028Help
Entry
65028             CDS       T01003                                 

Gene name
Dnaja1, Hsj2
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member A1
  KO
K09502  DnaJ homolog subfamily A member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    65028 (Dnaja1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    65028 (Dnaja1)
   04131 Membrane trafficking [BR:rno04131]
    65028 (Dnaja1)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP40 / DNAJ
   65028 (Dnaja1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Co-chaperones
    65028 (Dnaja1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA
Motif
Other DBs
NCBI-GeneID: 65028
NCBI-ProteinID: NP_075223
RGD: 620942
Ensembl: ENSRNOG00000007029
UniProt: P63036
Position
5q22
AA seq 397 aa AA seqDB search
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLADSKK
RELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYN
GATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMEC
QGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDII
IVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDI
KCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQ
VELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagaaactacttactatgatgttctgggggtcaaacccaatgccacccaggaa
gaattgaaaaaggcatatagaaaattggccttgaagtaccaccctgataaaaatccaaat
gaaggagaaaagtttaaacagatttctcaagcttatgaagttcttgctgattccaagaaa
agggaactatatgataaagggggcgagcaggcgattaaggagggcggagcaggtggaggt
tttggctcgcccatggatatctttgatatgttctttggaggaggaggaaggatgcaaaga
gaaaggagaggtaaaaatgtcgtgcatcagctctcagtgaccttagaagacttatataat
ggtgcaacaaggaaactggctctgcaaaaaaatgtgatttgtgacaaatgtgaaggccga
ggtggtaagaaaggagcagtagagtgctgtcccaactgccgggggactggcatgcagatc
aggattcatcagattggaccaggaatggttcagcaaattcagtcagtgtgcatggagtgc
cagggtcatggagaacgcatcagtcctaaagacagatgtaaaagctgcaatggaagaaag
atagttcgagagaagaaaattttagaagttcatattgataaaggcatgaaagatggtcag
aagataacattccacggtgaaggagaccaagaaccaggactggagccaggagatattatc
attgtgttagatcagaaggaccatgctgtttttacaaggcgaggagaagaccttttcatg
tgtatggacatacagctggttgaagcattgtgtggcttccaaaagccaatatctactctt
gacaaccgaaccatagtcatcacctctcatccaggtcagattgtcaagcatggggatata
aaatgtgtgctaaatgaaggtatgccaatataccgtcggccatatgaaaagggacgtcta
atcattgagtttaaggtaaactttcctgaaaatggctttctctctcctgataaactctct
ttgctggaaaaactccttcctgaaaggaaggaagtagaagagactgatgaaatggatcag
gtagaactggtggactttgatccaaatcaggaaagacggcgtcattataatggagaagcg
tatgaggatgatgagcatcaccccagaggtggcgttcagtgtcagacctcttaa

DBGET integrated database retrieval system