KEGG   Rattus norvegicus (rat): 65030Help
Entry
65030             CDS       T01003                                 

Gene name
Ephx2
Definition
(RefSeq) epoxide hydrolase 2
  KO
K08726  soluble epoxide hydrolase / lipid-phosphate phosphatase [EC:3.3.2.10 3.1.3.76]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00590  Arachidonic acid metabolism
rno01100  Metabolic pathways
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    65030 (Ephx2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    65030 (Ephx2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    65030 (Ephx2)
   01002 Peptidases [BR:rno01002]
    65030 (Ephx2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.76  lipid-phosphate phosphatase
     65030 (Ephx2)
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.10  soluble epoxide hydrolase
     65030 (Ephx2)
Protein phosphatases and associated proteins [BR:rno01009]
 HAD phosphatases
  Other HAD phosphatases
   65030 (Ephx2)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S33
   65030 (Ephx2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 HAD_2 Hydrolase_4 Hydrolase Hydrolase_like E2_bind
Motif
Other DBs
NCBI-GeneID: 65030
NCBI-ProteinID: NP_075225
RGD: 620732
Ensembl: ENSRNOG00000017286
UniProt: P80299
Position
15p12
AA seq 554 aa AA seqDB search
MALRVAAFDLDGVLALPSIAGVLRHTEEALALPRDFLLGAFQMKFPEGPTEQLMKGKITF
SQWVPLMDESCRKSSKACGASLPENFSISEIFSQAMAARSINRPMLQAAAALKKKGFTTC
IVTNNWLDDSDKRDILAQMMCELSQHFDFLIESCQVGMIKPEPQIYKFVLDTLKAKPNEV
VFLDDFGSNLKPARDMGMVTILVRDTASALRELEKVTGTQFPEAPLPVPCSPNDVSHGYV
TVKPGIRLHFVEMGSGPAICLCHGFPESWFSWRYQIPALAQAGFRVLAIDMKGYGDSSSP
PEIEEYAMELLCEEMVTFLNKLGIPQAVFIGHDWAGVLVWNMALFHPERVRAVASLNTPL
MPPNPEVSPMEVIRSIPVFNYQLYFQEPGVAEAELEKNMSRTFKSFFRTSDDMGLLTVNK
ATEMGGILVGTPEDPKVSKITTEEEIEYYIQQFKKSGFRGPLNWYRNTERNWKWSCKALG
RKILVPALMVTAEKDIVLRPEMSKNMENWIPFLKRGHIEDCGHWTQIEKPAEVNQILIKW
LKTEIQNPSVTSKI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgtgtggccgcgttcgaccttgacggagtgctggccctcccctctatagcc
ggggttctgcgccacaccgaggaggccctggcgctgcccagagacttcctacttggcgct
ttccagatgaaattcccagagggacccactgagcaactcatgaaaggaaagatcacattt
tcccagtgggtaccactcatggatgaaagctgcaggaagtcctccaaagcctgtggagcc
agtctacctgagaatttctccataagtgaaatattcagccaagccatggcagcaagaagc
atcaaccgccccatgcttcaggcagctgctgctctcaaaaagaaaggattcacaacgtgc
attgtcaccaacaactggctggacgacagtgacaagagagacatcctggcccagatgatg
tgtgagctgagccaacactttgacttcctcatagagtcctgtcaggtcgggatgatcaag
cctgagcctcagatctacaagtttgtactggacaccctgaaggcaaaacccaatgaggtt
gttttcctagatgactttggaagtaatctgaagccagcccgtgacatggggatggttacc
atcctggtccgcgacacagcctcggctttgagagaactggagaaagtcacagggacacag
tttcctgaggcacctctgccagtcccgtgcagtccaaatgatgtcagccatgggtatgtg
acagtgaagccagggatccgtctgcactttgtggagatgggctctggccctgctatatgc
ctctgtcatgggtttcctgagagctggttttcttggaggtaccagatccctgctctggcc
caggcgggctttcgtgttctagctatagacatgaaaggctatggagactcatcttctcct
ccagaaatagaagaatatgctatggaattgctgtgtgaggagatggtgacattcctgaat
aaactgggaatccctcaagcagtgttcattggccatgactgggctggtgtgctggtgtgg
aatatggctctcttccaccctgagagagtgagggctgtggccagtttgaacactccatta
atgccaccaaatcctgaggtgtcccccatggaagttatcagatcgatcccagttttcaac
tatcagctgtactttcaagagccaggagtggctgaggctgaactggaaaagaacatgagt
cggactttcaaaagcttcttccgaaccagtgatgatatgggtctcctcactgtgaataaa
gccactgaaatggggggaatccttgtgggaactccagaagatcccaaggtcagcaaaatt
actactgaggaggaaatagagtattacatacagcagttcaagaagtctggcttcagaggc
cctctaaactggtatcgaaacacagaaagaaactggaagtggagctgtaaggcgttggga
aggaagatcttggtccctgccctgatggtcacagctgagaaggacattgtactccgtcct
gaaatgtccaagaacatggaaaactggatccctttcctgaaaaggggacacatcgaagac
tgtggtcactggacacagatagagaaaccggcagaggtgaaccagattctcatcaagtgg
ctgaagactgaaatccagaacccatcggtgacctccaagatttag

DBGET integrated database retrieval system