KEGG   Rattus norvegicus (rat): 65044
Entry
65044             CDS       T01003                                 

Gene name
C1galt1
Definition
(RefSeq) core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00512  Mucin type O-glycan biosynthesis
rno00514  Other types of O-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    65044 (C1galt1)
   00514 Other types of O-glycan biosynthesis
    65044 (C1galt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    65044 (C1galt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     65044 (C1galt1)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 3 chain
   65044 (C1galt1)
SSDB
Motif
Pfam: Fringe Galactosyl_T FAM176
Other DBs
NCBI-GeneID: 65044
NCBI-ProteinID: NP_075239
RGD: 621105
Ensembl: ENSRNOG00000007804
UniProt: Q9JJ05
Position
4q21
AA seq 363 aa
MASKSWLNFLTFLCGSAIGFFLCSQLLNILLQEQADVQPNMLHNDPHARHSDDSGHNHLK
GQMDFNADSSQHKDENTDVAENLYQKVKVLCWVMTSPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPTVGLETKEGREQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLR
WLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVDAFKTEKCTHSSSIED
LALGRCMEIIKVEAGDSRDPTGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPVEGPGC
CSDIAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPALPENILKEINQVNKKEDTKIKL
GNP
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaattttttaactttcctctgtggatcagcaataggattt
ttcttatgttctcaactcttgaatattttgttgcaagaacaggctgacgttcagcctaac
atgcttcataatgatcctcatgccagacattcagacgacagtggacataatcacctcaaa
ggacagatggacttcaatgcagattctagccaacataaagatgagaacacagacgttgct
gagaacctctatcagaaagttaaagttctttgttgggttatgacaagccctcaaaatcta
gagaaaaaggccaaacacgtcaaagctacatgggcccagcgttgtaataaagtgttattt
atgagttcagaagaaaataaagacttccctactgtggggctggaaaccaaagaaggcaga
gagcaactgtactggaaaacaattaaagcgtttcagtacgtacatgaccattacttagaa
gatgctgactggtttatgaaagcagacgatgacacctatgtcatactggacaatctgaga
tggcttctatcaaagtataaccctgaacagcccatttactttgggagaagatttaagccc
tatgtgaagcagggatacatgagtggaggagcaggatatgtcctaagcaaggaagccttg
agaagatttgtggatgcatttaaaacagaaaaatgtacgcacagttcctccattgaagac
ttggccctgggaaggtgcatggagattataaaggtagaagctggagattccagagatccc
actgggaaggaaaccttccacccctttgtaccagaacaccacttaatcaaaggctatctg
ccaaaaacattttggtactggaattacaactactatcctcccgtagagggtcctggttgc
tgttctgatattgcagtttcttttcactatgttgattctacaactatgtatgaattagaa
tacctcgtttatcatcttcgtccatatggttatttatatagatatcaacctgccttacct
gagaatatactaaaagaaattaatcaagtaaacaaaaaggaagatacaaaaataaaatta
ggcaacccctga

DBGET integrated database retrieval system