KEGG   Rattus norvegicus (rat): 65047Help
Entry
65047             CDS       T01003                                 

Gene name
Slit1, MEGF4
Definition
(RefSeq) slit guidance ligand 1
  KO
K06838  slit 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    65047 (Slit1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    65047 (Slit1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   65047 (Slit1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_5 LRR_4 EGF Laminin_G_2 Laminin_G_1 LRR_9 LRRNT LRRCT hEGF EGF_2 Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 65047
NCBI-ProteinID: NP_075242
RGD: 69307
Ensembl: ENSRNOG00000026065
UniProt: O88279
Position
1q54
AA seq 1531 aa AA seqDB search
MALTPQRGSSSGLSRPELWLLLWAAAWRLGATACPALCTCTGTTVDCHGTGLQAIPKNIP
RNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQ
LQVLPELLFQNNQALSRLDLSENSLQAVPRKAFRGATDLKNLQLDKNQISCIEEGAFRAL
RGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFT
QCSGPASLRGLNVAEVQKSEFSCSGQGEAAQVPACTLSSGSCPAMCSCSNGIVDCRGKGL
TAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLN
SLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSL
AKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETTGARCASPRRLANKRIGQI
KSKKFRCSAKEQYFIPGTEDYHLNSECTSDVACPHKCRCEASVVECSGLKLSKIPERIPQ
STTELRLNNNEISILEATGLFKKLSHLKKINLSNNKVSEIEDGTFEGATSVSELHLTANQ
LESVRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTISPGAFDTL
QALSTLNLLANPFNCNCQLAWLGDWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCE
EGQEEVGCLPRPQCPQECACLDTVVRCSNKHLQALPKGIPKNVTELYLDGNQFTLVPGQL
STFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLH
GNDVSTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPPEME
GKLLLTTPAKKFECQGPPSLAVQAKCDPCLSSPCQNQGTCHNDPLEVYRCTCPSGYKGRN
CEVSLDSCSSNPCGNGGTCHAQEGEDAGFTCSCPSGFEGLTCGMNTDDCVKHDCVNGGVC
VDGIGNYTCQCPLQYTGRACEQLVDFCSPDLNPCQHEAQCVGTPEGPRCECVPGYTGDNC
SKNQDDCKDHQCQNGAQCVDEINSYACLCAEGYSGQLCEIPPAPRNSCEGTECQNGANCV
DQGSRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDNGIL
LYNGDNDHIAVELYQGHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVTFDQMVNLSID
GGSPMTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTSFHGCIRNLYINNEL
QDFTKTQMKPGVVPGCEPCRKLYCLHGICQPNATPGPVCHCEAGWGGLHCDQPVDGPCHG
HKCVHGKCVPLDALAYSCQCQDGYSGALCNQVGAVAEPCGGLQCLHGHCQASATRGAHCV
CSPGFSGELCEQESECRGDPVRDFHRVQRGYAICQTTRPLSWVECRGACPGQGCCQGLRL
KRRKLTFECSDGTSFAEEVEKPTKCGCAPCA
NT seq 4596 nt NT seq  +upstreamnt  +downstreamnt
atggcgctaacgccccagcgcgggtcctcttcggggttgagccgaccagagctgtggctg
ctgctatgggcagccgcgtggcgcctgggggccacggcgtgccccgccctctgcacctgc
accggcactacagtggactgccacggcacgggtttgcaggccatccccaagaacatccca
cggaacaccgagcgcctggaactcaatggtaacaatatcactcggatccataagaatgac
tttgctgggctcaagcagcttcgagtgttgcagctgatggagaaccagattggagctgtg
gaacggggagcttttgatgacatgaaggagttggagcggctacgactgaaccgcaaccag
ctgcaagtgttgcctgaactactgttccagaacaaccaggctctgtccagactggacctg
agtgagaattctctccaggctgtgcccagaaaggctttccgaggagccacagacctcaaa
aatctacagctggacaagaaccagatcagctgcatcgaggaaggggccttccgtgcccta
cggggactggaggttctgaccctgaacaacaacaacatcaccaccatccctgtgtccagt
ttcaaccatatgcccaagcttcggaccttccggctgcactccaaccacctgttctgtgac
tgtcacctggcctggctctcgcagtggctgagacagaggcccaccatcgggctcttcacc
cagtgctctgggcccgccagccttcggggcctcaatgtggcagaggtgcaaaagagtgag
ttcagctgctcaggccagggggaggctgcacaagtacctgcctgcaccctctcatccggt
tcctgcccagccatgtgcagctgtagcaatggcatcgtggactgccgtggcaaaggcctc
actgccatccctgctaaccttccggagacgatgaccgagatccgcctggagctgaacggt
atcaaatccatcccaccaggagccttctctccctacagaaagctgcgcaggatagacctg
agtaacaaccagattgctgagattgcacccgatgccttccaaggcctccgctccttgaat
tccctggtcctctatggcaacaagatcacagacttgccccgaggtgtatttggaggcctg
tacaccctccagctgctgcttctgaatgccaacaagatcaactgcatccggcctgatgcc
ttccaggacctgcagaacctctctctgctctccctatatgacaacaagatccagagtctc
gccaagggcaccttcacctccctgcgggccatccagacactgcatctggcccagaaccct
ttcatctgtgactgtaacctcaagtggctggcagacttcttacgtaccaaccccattgag
acaactggggcccgctgtgccagcccccggcgccttgccaacaagcgtatcgggcagatc
aaaagcaagaagttccggtgctcagccaaagagcagtacttcattccagggacggaggat
taccacctgaacagcgagtgtacgagtgacgtggcctgtccccacaagtgccgctgtgag
gccagtgtggtggagtgctctggcctgaagctctctaagatccctgagcgaatcccccag
tccacgactgagctacgactgaacaacaatgagatttcaatcctagaggccactgggttg
tttaagaagctctcacatctgaagaaaataaacctgagcaacaacaaggtgtcagagatt
gaagacgggacgtttgaaggcgccacctccgtcagcgagctgcacctgaccgccaaccag
ctggagtctgtcagaagcggcatgttccggggtctagatggcttgcggaccctgatgctg
aggaacaaccgtatcagctgcatccacaatgacagcttcactgggctgcgtaacgtgcgg
ctcctgtctctttacgacaaccacatcaccaccatctcccctggagccttcgacaccctc
caggccctgtccacactaaacctcctggccaacccattcaactgcaactgccagttggcc
tggctgggggactggcttcggaagaggaaaattgtgacagggaaccctcgctgtcagaac
ccagacttcctgcggcagattcctctgcaagatgtggccttccctgacttcaggtgtgag
gaaggccaggaggaggtgggctgcctgccccgcccacagtgcccccaagagtgcgcctgc
ctggacaccgtggtccggtgtagcaacaagcacctccaggctctgcccaagggcatcccc
aagaatgtcacagaactctacttggatgggaaccagttcacactggttccgggacagctg
tctaccttcaagtatctgcagcttgtcgacctgagcaacaacaagatcagctccttaagc
aactcttccttcaccaacatgagtcagctgaccacactgatcctcagctacaacgccctc
cagtgcatcccccctctggccttccaaggacttcgttcactgcgcttgctgtctttgcat
ggcaatgatgtctccaccctccaagagggaatctttgcagacgtgacgtctctgtctcac
ctggccattggtgccaaccccctgtactgcgactgccacctccgatggctctccagctgg
gtgaagactggctacaaggaacctggcattgcccgctgtgctggacccccagagatggag
ggcaaactgttgctcaccacacctgccaagaagtttgaatgccaaggtccccccagcctg
gcggttcaggccaagtgtgatccctgcttgtccagcccatgccagaatcagggcacttgt
cacaatgaccctcttgaggtatacaggtgtacctgccccagtggctacaagggccgaaac
tgtgaggtgtctctggacagctgttccagcaacccatgtggaaatgggggaacctgccat
gcccaggagggcgaggatgctggcttcacgtgctcctgtccttccggctttgaagggctg
acgtgtggaatgaacacagatgattgtgtgaagcacgactgtgtcaatgggggtgtctgt
gtggatggcatagggaattacacatgtcagtgccccctgcagtacacaggaagggcctgt
gaacagctagtggacttctgctctccggatctgaacccatgtcagcatgaggcccaatgt
gttggcaccccagaggggcccaggtgtgagtgtgtgccaggctacacgggtgacaattgc
agcaaaaaccaggacgactgcaaggaccaccagtgtcagaacggggctcagtgtgtggat
gagatcaacagctacgcctgtctctgtgctgagggctacagcggacagctctgtgagatc
ccacctgcccccaggaactcctgtgaagggactgagtgccagaatggagccaactgtgta
gaccagggcagccggcccgtatgccagtgcctaccaggctttggaggtcccgaatgtgag
aagttgctcagtgtcaactttgtggaccgggacacttacctgcagttcactgacctgcag
aactggcctcgggccaacatcactcttcaggtctccacagcagaggacaatgggatcctc
ctctacaatggggataatgaccacattgcagttgagctgtaccagggccatgtccgtgtt
agctacgacccaggcagctaccccagctctgctatctacagtgctgaaacaatcaacgat
gggcagttccacacagttgagctggtgacctttgaccagatggtgaacctctccattgat
ggtggcagccccatgaccatggacaactttggaaagcactacacactcaacagtgaggcc
cccctctatgtgggagggatgcccgtggatgtgaactcagctgccttccgcctgtggcag
atcctcaatggcaccagcttccacggttgcatccggaatctatacatcaacaacgaactg
caggacttcaccaagacacagatgaagccgggcgtggtgcccggctgcgagccctgccga
aaactctactgtctacatggcatttgccagcccaacgccaccccagggcccgtgtgccac
tgcgaggctggctgggggggcctgcactgtgaccagccagtggacggcccctgccatggc
cacaagtgtgtccatgggaaatgcgtgcccctcgatgcacttgcctacagctgccaatgc
caggatggatactcgggggctctgtgcaaccaggtcggggctgtggcagagccctgtggg
ggcttacagtgcctgcatggtcactgccaggcctcggccaccagaggggcacactgtgtg
tgcagcccaggtttttcaggcgagctgtgtgagcaagagtccgagtgccggggggaccct
gtccgggactttcaccgggtccagaggggctatgccatctgccagaccacgcgcccactg
tcatgggtggaatgccggggcgcgtgcccgggccagggctgctgccagggcctgcggctg
aagcggaggaagctcaccttcgagtgcagcgatgggacctcgtttgctgaggaggtggag
aagcccaccaagtgcggctgtgccccgtgtgcgtaa

DBGET integrated database retrieval system