KEGG   Rattus norvegicus (rat): 65156Help
Entry
65156             CDS       T01003                                 

Gene name
Dhodh
Definition
(RefSeq) dihydroorotate dehydrogenase (quinone)
  KO
K00254  dihydroorotate dehydrogenase [EC:1.3.5.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00240  Pyrimidine metabolism
rno01100  Metabolic pathways
Module
rno_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    65156 (Dhodh)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.2  dihydroorotate dehydrogenase (quinone)
     65156 (Dhodh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHO_dh FMN_dh NMO Trp_syntA
Motif
Other DBs
NCBI-GeneID: 65156
NCBI-ProteinID: NP_001008553
RGD: 68352
Ensembl: ENSRNOG00000015063
UniProt: Q63707
Structure
PDB: 

Position
19q12
AA seq 395 aa AA seqDB search
MAWRQLRKRALDAVIILGGGGLLFTSYLTATGDDHFYAEYLMPGLQRLLDPESAHRLAVR
VTSLGLLPRATFQDSDMLEVKVLGHKFRNPVGIAAGFDKNGEAVDGLYKLGFGFVEVGSV
TPQPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAQLTADGLPLGIN
LGKNKTSEDAAADYAEGVRTLGPLADYLVVNVSSPNTAGLRSLQGKTELRHLLSKVLQER
DALKGTRKPAVLVKIAPDLTAQDKEDIASVARELGIDGLIVTNTTVSRPVGLQGALRSET
GGLSGKPLRDLSTQTIREMYALTQGRIPIIGVGGVSSGQDALEKIQAGASLVQLYTALIF
LGPPVVVRVKRELEALLKERGFTTVTDAIGADHRR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggagacagctgagaaagcgggccctggatgcagtcatcatccttggaggtgga
ggacttctcttcacctcttacctgacggccacaggggatgaccatttctatgctgagtac
ctgatgccaggtctgcagaggctgcttgatccagagtcagcccaccggctagctgttcga
gtcacctccctggggctccttcctcgagctacatttcaggactccgacatgctggaagtg
aaagtcctgggccataaattccgaaatccagtaggaattgctgcaggatttgacaagaac
ggcgaagctgtggacggactctacaagctgggctttggtttcgttgaggtaggaagtgtc
actccccagcctcaggaaggaaaccccaggcctagagtattccgtctccccgaggaccaa
gctgtcattaacaggtatggattcaacagccatgggctctcggtggtggaacacaggcta
cgggccagacagcagaagcaggcccagctcactgcagatgggctgcctcttggaataaac
ctggggaagaataagacttcggaggatgctgctgcagactatgcagagggtgttcgaacc
ctgggccccttggctgactacctggtggtaaacgtgtccagccccaacactgctggtctg
aggagcctacaggggaagaccgaactgcgccacctgctgtccaaggtgctgcaggagagg
gacgccttgaagggcacacggaagccagcagtgctggtgaagattgcccctgacctcacg
gcccaggacaaggaggacattgccagcgtggcgagagagctgggcatcgatggactgatt
gtcacaaacaccacagtgagtcgccctgttggtctccagggtgctctgcgctctgagaca
ggaggactgagtgggaagccactccgagatctgtcgactcagaccatccgggagatgtac
gcccttacccaaggcaggattcccattatcggggttggtggtgtgagcagcggacaggac
gccttggagaagatccaggcaggggcctccctggtgcagctctacacagccctcatcttc
ctgggaccaccagtcgtggtcagggtcaagcgtgaactagaggcccttctaaaagagcgg
ggttttaccacagttacagatgccattggagcagatcatcggaggtga

DBGET integrated database retrieval system