KEGG   Rattus norvegicus (rat): 65209Help
Entry
65209             CDS       T01003                                 

Gene name
Dync2h1, Dnch2, Dnchc2
Definition
(RefSeq) dynein cytoplasmic 2 heavy chain 1
  KO
K10414  dynein heavy chain 2, cytosolic
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04962  Vasopressin-regulated water reabsorption
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    65209 (Dync2h1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    65209 (Dync2h1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    65209 (Dync2h1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    65209 (Dync2h1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    65209 (Dync2h1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      65209 (Dync2h1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     65209 (Dync2h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_6 DHC_N2 AAA_9 AAA_8 Dynein_C AAA_5 AAA_lid_11 DHC_N1 Dynein_heavy AAA_7 MT AAA_22 AAA_16 RsgA_GTPase AAA ABC_tran AAA_24 AAA_30 IstB_IS21 AAA_18 ATPase_2 RNA_helicase AAA_28 AAA_29 AAA_33 AAA_23 ERM
Motif
Other DBs
NCBI-GeneID: 65209
NCBI-ProteinID: NP_075413
RGD: 71042
Ensembl: ENSRNOG00000032070
UniProt: Q9JJ79
Position
8q11
AA seq 4306 aa AA seqDB search
MAGSLSDVRKLFLFTTTQNYFGLRPELWDQTPLSNCPEVNNFLDDGNQMLLRVQRSDAGL
AFSNTIDFDDTKDKVLVFFKLRPEVITDGNLHTNILVSSMLESPINSLYQAVRQVFAPML
LKDQEWSRNFDPKLQNLLSELEAGLGVVLRKSDTNLPKLKLKEDDTRGILTPSDEFQFWI
EQAHRGSKQISKERASYFKELFETIAREFYNLDSLSLLEVVDLVETTRDVVDDVWRQAEH
DHYPESRMLHLLDVIGGSFGRFVQKKLGSLKLWEDPYYLVKENLKAGISICEQWVIVCSH
LTGQVWQRYVPHPWKSEKYFPETLDRLGKRLEEVLAIRTIHEKLLYFLPASEERIVCLSR
VFEPFTGVNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDSPQQLLQA
FLKYKELVKRPTISKELMLERETLLARLGDSAKDFRLDFENRCRGIPGDASGPLSGKNLS
EVVNNIVWVRQLELKVDDTIKIAEALLSDLSGFRSFHRSAEDLLDQFKLYEQEQFDDWSR
EVQSGLSDSRSGLCIEANSRIMELDPNDGALKVHYSDRLVILLREVRQLSALGFVIPAKI
QQVANVAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGK
SQITWDNPKELEGYIQKLQNAAERLATENRRLRKWHITFCEKVVILMNIDLLRQQQRWKD
GLQELRTGLASVAAQGFQPSDMRAWRQHWNHQLYKALEHQYQMGLEALNENLPEINVDLT
YKQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGGAGDESIFSVMIDRNASGFLTIY
SKAEDLFRRLSAVLHQHKEWVVIGQVDMEALVEKNLSTVHDWEKNFKALKIKGKEVERLP
SAVKVDCLNINCSPVKTVIDDLIQKLFDLLVLSLKKSIQTHIHEIDTFVTEAMKVLTVIP
QSVEEIGDTNLQYSNLQDRRPEILPLFQEAEDKNRLLRTVAGGGVETVSNLRAKWDKFEL
MMESHQLMIKDQIEVMKGNVKSRLQIYYQELDKFKARWDQLKPGDDIIETGQQNTMDQSA
KSIKEKKIEFDDLEVIRKKLVDDCHHFGLEESNFSLAYSISKDIESCAQIWALYEEFQQG
LQEMAKEDWITYRTKIYIFEEFLINWHERLRKVEEHSVMTVKLQSEVDRYKIIIPILKYV
RGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVEKASDLKDLNSRAQGEVTI
REALRELDLWGVGAVFSLIDYEDSQNRTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKG
FEDKVSIWERKLAQLDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNKVDEDFRSIMM
DIRKDSRVTTLTTHAGIRNTLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEI
LGQSTNPSVIQSHLKKLFAGINSVCFDEESKHITAMRSLEGEVVPFKSKVLLSNNVEAWL
NDLALEMKQTLKQLLKECVTAGRSSQGAIDPSLFPSQILCLAEQIKFTEDVEDAIRDHSL
HQIEAQLAAKLERYTSVDTSSEDPGNSESGILELKLKTLILDIIHNIDIVKQLNQAQVHT
TDDWAWKKQVRFYMKSDHTCYVQMVDSELQYTYEYQGNAPKLVYTPLTDKCYLTLTQAMK
MGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCF
DEFNRLEEAVLSAVSMQIQTIQDALKNHRSVCELLGKEVEVNANSGIFITMNPAGKGYGG
RQKLPDNLKQLFRPVAMSRPDNDLIAEVILYSEGFKDAKELGRKLVAIFNLSRELLTPQQ
HYDWGLRALKTVLRGSGNLLRQLKKSGTKQDVNENHIVVQALRLNTMSKFTFADCTRFDA
LIKDVFPGIDFKEVEYNELSSALKQVFEEANYEVIPNQMKKALELYEQLRQRTGVVIVGP
SGAGKSTLWRMLRAALCKIGKVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQ
VVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLS
CASPATISRMGMIFLSDEETDLNSLIKSWLRNQPVEYRSNLENWIGDYFSKALQWVLKQN
DYVVETSLVGTVMNGLSHLHGCKYHDQFIINLIRGLGGNLNMKSRLEFTKEVFNWARETP
PDSHRPMDTYFDCDRGQLASYVLKKPESLTADDFSSGHSLPVIQTPDMQRGLDYFKPWLS
SETKQPFILVGPEGCGKGMLLRYAFSQLRSTEIATIHCSAQTTSRHLLQKLSQTCMVIST
NTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENI
QIVASMSAGGRLGRHKLTTRFTSIVRLCAVDYPEREQLQTIYGAYLEAVLHKNLKNHSIW
GSSSKIYLLAGSMVQVYEQVRAKFTVDDYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPL
DYVLEVVAYEARRLFRDKIVGVKELHLFDNILTSVLQGDWGSDILDNMADSFYVTWGAQH
ISGAKIAPGQPLPPHGKPLGKLSSADLKDVIKKGLIHYGRDNQNLDILLFQEVLEYMSRI
DRVLSFPGGSLLLAGRSGVGRRTVTSLVSHMHGAVLFSPKISRGYEPKQFRTDLKHVLHL
AGIEAQQVVLLLEDYQFVHPTFLEMINSLLSSGEVPGLYTLEELEPLLLPLKDQASQDGF
FGPVFNYFTYRIQQNLHIVLIMDSANLNFIINCESNPALHKKCRVLWMEGWSDSSMKKIP
EMLFSEADIEEKYEKKRKDEKKKSSVDPDFIKSFLLIHESCKAYGATPSRYMTFLRVYSA
ISSSKRKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSILLRIKQDEADSALQEITV
SMQDASEQKTELERLKHRIAEEVVKIEERKSKIDDELKEVQPLVNEAKLAVGNIRPESLS
EIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNIPKEIRE
SVEELLFKNKASFDPKNAKRASTAAAPLAAWVKANVQYSHVLERIQPLETEQSGLELNLK
KTEDRKRKLEDLLNSVGQKVSELKEKFQSRTSEAAKLEAEVSKAQETIKAAEVLISQLDR
EHRRWNAQVAEIAEELATLPKRAQLAAAFITYLSAAPEGLRKNCLEEWTKAAGLEKFDLR
RFLCTESEQLIWKSEGLPSDDLSIENALVILQSRVCPFLIDPSSQATEWLKTHLKDSHLE
VINQQDSNFITALELAVRFGKTLIIQEMDGVEPVLYPLLRRDLVAQGPRYVVQIGDKIID
YNEDFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKTK
LLQQEEDKKIQLARLEESLLETLATSQGNILENKDLIESLNQTKASSALIQDSLKESYKL
QISLDRERDAYLPLAESASKMYFIISDLSKINNMYRFSLASFLRLFQRALQNKQDSESTE
QRIQCLVNSLKHMVYEYICRCLFKADQLMFALHFVRGMHPEFFQENEWDTFTGVVVGDML
RKADSQQRIRDQLPSWIDQERSWAVATLKISLPGLYQTLCFEDGTLWRTYYHHSMCEQEF
PSILAKKVSLFQQVLVVQALRPDRLQSAMALFACKALGLKELSPLPLNLKRLYKETLEIE
PILIIISPGADPSQELQELANAERSSERYHQVAMGQGQADLAIQMLKECARNGDWLCLKN
LHLVVSWLPVLEKELNTLQPKESFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNLM
RTYESWTPEQISKKDNIHRAHALFSLAWFHAACQERRNFIPQGWTKFYEFSLSDLRAGYH
VIDRLFDGSKDVQWEFVHGLLENSIYGGRIDNYFDLRVLQSYLKQFFNSSIIDVLNQRNK
KSIFPYSISLPDSCSILDYRAVIEKLPEDDKPSFFGLPANIARSSQRMTSSQVISQLRIL
GRSVTAGCKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVSPPNDRQGSPILSFIILEQF
NAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLTWQSKWEGPEDPLQYL
RGLVARTLAIQNWVEKAEKQALLADTLDLSELFHPDTFLNALRQETARATGCSVDSLKFV
ASWKGRLQEAKLQIKISGLLLEGCSFDGSRLSENQHDSPSVSSVLPCYMGWTPQGSYGPY
SPDECISLPVYTSAERDCVVTNIDVPCGGNQDQWIQCGAALFLKNQ
NT seq 12921 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaagcctcagcgatgtccgtaaactctttctttttacgaccacccagaattac
ttcggactgagaccggagctctgggaccagaccccgttgagcaattgcccggaggtgaac
aacttcttggacgacgggaaccagatgcttcttcgggtgcagcggtccgatgctgggctg
gccttttccaacacgattgattttgatgacacaaaagacaaagtgctggtgtttttcaag
ctccgaccagaagtaattacagatggcaatctgcataccaacattcttgtttcctctatg
ctggaatcgcctatcaactccctttaccaagcagtgcggcaggtgtttgcacccatgttg
ctgaaggaccaggaatggagcagaaactttgatcctaaacttcagaatcttttgagtgaa
ctagaagctggattgggtgtagtcctacgaaaatcagatactaacttacccaagctgaaa
cttaaggaagacgatactagaggtattctcacaccaagtgatgaattccagttttggata
gaacaagctcatcgtgggagcaaacagattagtaaagaaagagccagttattttaaggaa
ttatttgaaacaattgcaagggaattttataacttggacagtctgtccttgctagaagtt
gttgacttggtggagacaactcgggatgttgtagatgatgtgtggcgacaggcagagcat
gatcattaccccgagtcacgcatgctgcatctgctggatgtcataggtggttcatttgga
aggtttgttcagaaaaagctgggaagcttgaaactgtgggaagacccttattatctcgtg
aaagaaaaccttaaagctggcatttccatttgtgaacagtgggtgatagtctgcagtcac
ctcacaggccaggtctggcagcgctatgtccctcatccatggaaaagtgagaagtatttc
ccagaaactcttgacagactgggcaaacggctggaggaggtcttggctattcgaacaatt
catgagaagctcttgtattttttacctgccagtgaggagagaattgtatgcctgtctcga
gtgtttgaaccttttactggcgtgaaccctgtgcagtacaatccttatactgagccttta
tggaaagctgcagtgtctcagtatgagaagatcattgcaccagcagagcagaaaatagca
gggaaattaaagaattatatttcagaaattcaagatagtccacagcagcttctccaagcg
tttctaaaatacaaagaattggtgaagcgtcccaccataagcaaagaactgatgttagag
agagagactttactggcaagacttggggattcagctaaagattttcgattggactttgag
aatcggtgccgaggaattcccggtgatgcatctggaccactttctggcaaaaatctctca
gaagttgtgaataatattgtttgggttcgtcagttggaattgaaggtagacgatactatc
aagattgcagaagcgcttttgtctgacttgtcaggatttcgatcttttcatcgaagtgct
gaagacctcttggaccagttcaagctctatgaacaagaacagtttgatgactggtcaaga
gaagtccagtcagggttgtctgactccaggtcaggtttgtgtattgaggccaacagccga
ataatggaattggatcctaatgatggggcattaaaagttcattattctgatcgcctggtg
attcttctgagagaagtccgtcagctttctgccctgggctttgtcattcctgccaaaata
cagcaggttgcaaatgttgctcagaagttctgcaagcaagcgatcattcttaagcaagtg
gcacatttttacaattctattgatcaacagatgattcagagtcagaggccaatgatgctg
cagtctgccttagcatttgaacagataattaaaaattcaaaggcagggagcggaggcaag
tcacagattacttgggacaatcctaaagaactagaaggctacatccagaaactccaaaat
gctgctgagcgacttgccactgagaatcgaaggctaagaaagtggcatattacgttttgt
gaaaaggtggtcattcttatgaatattgatctacttcggcagcagcagcgttggaaggat
gggctgcaggagctgagaactggcttagcgagtgtggccgcacagggcttccaacccagt
gacatgcgtgcgtggcggcagcactggaaccaccagctgtacaaggctctggagcatcag
tatcagatgggtctggaggcactgaacgagaacctgccagaaataaacgtcgacttaacc
tacaaacagggaaggttacagtttagacccccttttgaagaaatccgggctaaatattac
agagaaatgaagaggttcatcggaattccgaatcagtttaagggtgtgggcggggctgga
gatgaatcaatattttctgtcatgattgacagaaatgcaagtggatttctgactatttac
agcaaagcagaagacctgtttagaagactttcagctgtattgcaccaacataaggaatgg
gttgtgattggacaggtcgacatggaagctctggtcgaaaagaacctttctactgtccat
gattgggagaaaaattttaaagcattgaaaataaaagggaaagaagttgaacggcttccc
agtgctgtcaaggtggactgtctcaacatcaactgcagccctgtgaagactgtgatcgat
gacctcatccagaagttatttgatctgcttgtgctttctctgaagaagtccatccagact
catatacatgaaattgatacatttgttactgaggctatgaaggtcttaacagttatacct
caatctgtggaagaaataggagatacaaatttacagtatagtaacctgcaggatcggagg
ccagagattttgcccttgtttcaagaagctgaagacaaaaacaggcttttgcgaactgtg
gcaggtggaggggtagagacagttagcaatctgagagccaagtgggacaaattcgagctg
atgatggaaagtcaccaacttatgattaaagatcagatagaagtgatgaagggaaatgtg
aagtcccgccttcagatctattaccaagagttggacaagttcaaggctcgctgggaccag
ttgaaacctggggatgatattattgaaactggccaacaaaataccatggatcaaagtgca
aagtctataaaggagaaaaaaattgagtttgatgatctggaagtcataagaaagaagcta
gttgatgactgccatcattttggactagaagagtctaacttctctttggcatatagcatc
tctaaggacattgaaagctgtgcacagatttgggctctttatgaggagttccagcaagga
ctccaggaaatggccaaagaagattggattacttaccggactaagatctacatatttgaa
gaatttttgattaactggcatgagagattaaggaaggttgaagaacattcagtcatgaca
gtgaagttacagtcagaagttgacagatacaaaattattattcctatcctgaaatatgtg
agaggggagcatctttctccagaccactggcttgacctttttcgtttacttggccttcct
cgagggactagtctagagaaactactgtttggtgacctgctcagagtcgctgatacgatt
gtggagaaagcctcagaccttaaagatttaaatagtcgggcacaaggggaagttaccatc
agagaagctttgcgtgaacttgatctatggggagttggagcagtgttctcattaattgat
tatgaagacagccagaatcgaactatcaagctgattaaagactggaaagacatagtgaac
caggttggagataatagatgccttcttcagtccttaaaagattctccatattacaaagga
tttgaagataaagtatcaatttgggaaagaaaacttgcacagttggatgagtacctgcag
aatttgaaccatatccagagaaaatgggtatatttagagcccatttttgggcgtggagct
ttgcctaaagaacagacacgcttcaacaaagttgatgaagatttcagatcaataatgatg
gacatcaggaaagacagtagagtcaccacattgactactcatgcaggaatcagaaacact
ctgctgacgatacttgatcagcttcaaagatgccagaaatccctaaatgaatttttggag
gaaaaacgttcagcattcccaagattttattttattggtgatgatgacttgttagaaatc
ctgggccagtctaccaacccgtcagtgattcagtcccatctgaagaagttgtttgccggt
atcaacagtgtgtgctttgatgaggagtccaaacatataactgcaatgaggtcactggag
ggagaagtggtaccttttaagagtaaagttctcctatcaaataatgtagaggcatggttg
aatgatctggctttggaaatgaagcaaactctgaaacagttgttgaaagaatgtgttaca
gctgggcgaagttcacaaggtgcaattgacccatctctcttcccttcccagatactgtgt
ttggctgagcagatcaagtttactgaagatgtagaagatgccatcagggaccacagtctc
caccagattgaagcacagctcgcagctaagttggaacgctacaccagtgttgacacaagc
tctgaggacccagggaattcagaatcaggaattctggagcttaagcttaaaacactaatt
cttgatattattcataatattgatattgtgaagcaattaaaccaagcacaagttcataca
actgatgactgggcttggaagaaacaagttagattctacatgaaaagtgaccatacatgc
tatgttcaaatggtggattctgaacttcagtatacatatgagtaccagggtaatgcaccc
aagctggtttatactccactgacagacaagtgctacctaactctcactcaagccatgaag
atgggacttggagggaatccctatggacccgctgggactggaaaaactgagtcagtaaag
gctctaggtggacttcttgggagacaagttttggtttttaactgtgatgagggcattgat
gtgaaatcaatggggcggatatttgttggtttggtgaaatgcggggcctggggttgcttt
gatgagttcaatcgactggaagaagctgttctttcagccgtttccatgcagatccagacc
attcaggatgctttgaagaaccacagaagtgtgtgtgagctgcttggcaaagaggttgaa
gtaaatgccaattctggaatttttatcaccatgaatcccgctggaaaaggttatggagga
agacaaaaacttccggataaccttaaacagctcttcaggccagtggcaatgtcgcgtcca
gacaatgatctcatagcagaagtaattctgtattcagagggcttcaaagatgctaaagaa
ttaggcagaaagttggtcgctattttcaacctatctagggaacttttgactcctcagcaa
cattatgactggggactgagagctttgaagacagttctaagaggaagtgggaatcttctg
agacagttgaagaaaagtggcacaaaacaagatgttaatgaaaatcacattgtggtgcaa
gcattgagacttaatacaatgtcaaaattcacattcgctgattgcacacggtttgatgca
ctgattaaagatgtcttccctggcattgactttaaagaagtagaatacaatgaactaagt
tctgcattgaagcaagtctttgaggaggccaattatgaagtcatacccaatcagatgaag
aaggctctagagttatatgagcagttgcgccaaaggacgggcgttgttattgttggtcca
agtggtgctggcaagtctaccctttggagaatgttaagggctgcactttgtaaaattggc
aaagtagtaaaacagtacactatgaatcccaaagcaatgccgagacatcagttattagga
cacattgatatggatacaagagaatggtctgatggtgtcttgacaaatagtgctcgccaa
gtagttcgtgagcctcaagatgtcagctcatggataatctgtgatggtgacattgaccct
gaatggatagaatctctgaattctgttctggatgataatcggctgctcaccatgcccagt
ggagaaaggattcagtttggtccaaatgttaactttgtatttgaaactcatgatttaagt
tgtgcttcgccagccacaatatctagaatgggaatgatatttcttagtgatgaagagaca
gatcttaattctctcataaaatcttggttgaggaatcagcctgttgaatacagaagtaat
ctcgaaaactggattggagattatttttcaaaagcgttacagtgggttttaaagcagaat
gattatgtggtagaaacaagtttggttgggactgtgatgaatggtttgtcccacctccat
ggatgcaaatatcatgaccagtttattattaatcttatacgaggacttggtggaaatctg
aatatgaaatcgcgtctggaatttaccaaggaggtctttaattgggcacgggagacccct
cctgactctcacaggccaatggacacctactttgactgtgaccgagggcagttagcgtcc
tatgtactgaagaagccagagagcctgacagctgatgacttcagcagtggccacagcctt
cctgtcattcagactcctgatatgcagcgaggtttagattatttcaaaccctggctaagt
tcagaaaccaaacagccatttattctggtaggaccagaaggatgtggcaaagggatgctg
ctcaggtatgccttctctcaactccgctccaccgagattgccactatccactgcagtgcc
cagactacttctcgacatcttctgcagaaactgagccagacttgcatggtaatcagtaca
aatactggtcgagtatacagaccaaaagattgtgaaagacttgttttgtatctaaaagat
atcaacctgcccaagcttgataaatgggggaccagcactttggtggctttcctccagcag
gtgttgacatatcaaggattttatgatgaaaatttggaatgggttggactggagaatatt
caaattgtagcttccatgtcagctggaggaagattggggcgacacaagctgaccaccagg
tttacatctattgttcgtctttgtgccgtcgattacccagaaagagaacagttacagaca
atctatggagcatatttggaagcagttctgcacaaaaatctgaagaatcattctatttgg
ggttcttcatcaaaaatttatctcttagcaggctctatggtgcaggtgtatgaacaggtg
cgggctaaattcacagtggatgattacagccactatttcttcacaccctgcattcttact
cagtgggttcttggcttgttcagatatgatttagaaggaggatcctctaaccatccatta
gattatgtgctagaagttgtcgcctatgaagcacggcgcttgtttcgggacaaaattgtt
ggcgtgaaggagctgcatttgtttgataacattttaacttcggtgctccaaggagactgg
ggctcagacatactggacaacatggcagatagtttctatgttacatggggagcccaacat
atctcaggagcaaagatagctccaggacagcctttacctccgcatgggaaaccacttggc
aaactgagctctgcagacctgaaggatgtcattaagaagggtcttattcattatggacga
gataaccagaatttagacattttactcttccaagaagttctggaatacatgtcaaggata
gacagagtactgagtttccctggaggctcccttctgttggcaggacgaagcggcgtgggg
cggcggactgtcacgtctttggtcagtcacatgcacggtgctgtgctcttctccccgaag
atctccaggggctacgagccgaagcagttcagaaccgacctcaagcatgtactgcacctt
gcaggaattgaagcacagcaggtagtcttacttcttgaggattaccagtttgtacatccc
acattcttggagatgatcaatagccttttgtcttcaggcgaggttcctggactgtatact
cttgaagaattggagcctttgctgttgcctctgaaagaccaagcttctcaggatggattt
tttggaccagtcttcaattacttcacatacagaattcaacaaaacttgcatattgtcttg
attatggattctgcaaatctgaacttcataataaactgtgagagtaatccagctttgcat
aagaagtgccgggtgctgtggatggagggctggtcagacagcagtatgaagaagatacca
gaaatgttattcagtgaagcagacatcgaagaaaaatatgaaaaaaaaagaaaagatgaa
aagaaaaaaagttcagttgatcctgacttcataaagtcattcttattgatccatgagtct
tgcaaagcttacggggccaccccaagcaggtacatgacctttctgcgtgtgtattctgcc
atcagcagcagcaagaggaaggagctactgaagagacagagtcatttgcaggctggcgtg
tccaaactaaatgaagccaaagctcttgtggatgagctgaacagaaaggccggagagcag
agtatcctgcttcgaataaagcaggatgaagcagactctgcccttcaggagatcacagtg
tccatgcaggatgctagtgagcaaaagacagaacttgaaagactgaaacatcggatagca
gaagaagttgttaaaattgaagagagaaaaagtaaaattgatgatgaattaaaagaagta
caacctctagtcaatgaagctaagctagcagttggaaacattaggccagaatctctttca
gaaatccgttcactccgcatgccaccagatgtaatccgagatattcttgaaggagttttg
aggttaatgggtatctttgatacatcatgggtaagcatgaaaagcttccttgcaaaaagg
ggtgtgagagaagacattgcaacttttgatgcacggaacatccctaaagagatacgagag
agtgtggaggagcttctcttcaaaaacaaagcctcttttgatccaaagaatgctaagcgt
gccagcactgcagctgctcctttggctgcttgggtaaaggccaatgtacagtactcccat
gtcttggaacggatccagcctctggaaacagagcagtcaggattagaattaaatttgaag
aaaactgaagacaggaaaaggaagctagaagatcttctgaactctgttggtcagaaagtg
tcagaactcaaagaaaaatttcagagcaggacttcagaagctgccaaactggaagctgaa
gtcagcaaggcacaggagaccatcaaagctgcagaggtcctcattagtcagctagacaga
gaacacaggagatggaatgcccaggttgctgagatagctgaagagttagccactctcccc
aaaagagctcagctagcggccgctttcatcacctatctttctgctgctccagaaggcctc
aggaagaactgtctggaagagtggacgaaggcagctggcctcgagaaatttgatctcagg
cggtttctctgtactgaaagtgagcagttgatctggaaaagtgaaggccttccatctgat
gacctttccattgagaatgcccttgtgatcttacagagtcgagtgtgcccatttctgatt
gatccatcttctcaggcaacagagtggttaaagacacatctgaaggactcacatttggaa
gttattaaccaacaggacagtaactttatcacagctcttgagttggcagtacgttttggg
aaaaccctcattatacaagagatggatggagtagaacctgttctttatccgctgctgaga
cgagatctggttgctcaaggacctcggtatgtggtacaaataggtgacaagatcattgac
tacaatgaagatttccgccttttcttgtcaacaagaaatccaaatcctttcatcccaccg
gatgctgcatccatcgtgactgaggtgaactttactacaacaagaagtggactgcgagga
cagcttttagctttaaccattcagcatgaaaaacctgacctagaagagcagaaaacaaaa
ctattacagcaggaagaagataagaaaatacagctggctagacttgaggagtctctgtta
gagacacttgccacatctcaaggtaatattttggaaaataaggatttgattgaatctttg
aatcagacaaaagcaagcagtgctcttattcaagactcacttaaagaatcttacaaactc
cagatttcccttgatcgggagcgtgatgcctacctgcctctggctgagagtgccagcaag
atgtacttcatcatctccgacttgtccaagattaataacatgtaccgtttcagtttggct
tcttttctccgactttttcaacgagctctgcagaacaagcaggactctgaaagtacagaa
caaagaatccagtgtctcgtgaattcattgaaacatatggtttatgaatatatatgcaga
tgcctgtttaaggctgaccagttgatgtttgctttgcattttgttcgaggaatgcatcct
gaattttttcaagaaaatgaatgggatacattcacaggtgtggttgttggagacatgctg
cgcaaagctgactctcaacagagaattcgtgatcaacttccatcttggatagatcaggaa
aggagctgggcagttgcaacattgaagatctctctccctggtctctaccagactctctgc
tttgaagatgggacactttggcgtacttactaccatcactcgatgtgtgaacaggagttt
ccatcaattctcgcaaagaaagtttccttatttcagcaggttcttgtagttcaggctctg
cggccagacagactgcagagtgccatggctctgtttgcctgcaaggctctggggttaaag
gagttatcccctcttcctctgaacctcaaacgcttatacaaggagacacttgagattgag
cccattttgatcataatctctccgggggctgacccttctcaggaacttcaggaacttgct
aatgctgaaagaagcagtgagcgttatcaccaggttgccatgggtcaaggtcaagctgat
ttagcaattcagatgctaaaagaatgcgcccgaaatggagactggctctgtttgaagaac
ttacatctcgtagtgtcttggcttccagttctggagaaggaattgaatactcttcaacct
aaagaaagctttcgtctctggctcactgcagaagttcatcccaactttactcccatatta
ctccaatcaagtctaaagataacatatgagtcacctccaggtttgaagaagaatttgatg
cgcacttatgagtcttggactcctgagcaaattagcaaaaaagataatatacaccgagct
catgctctttttagcttagcatggtttcatgctgcctgtcaagaaagaagaaattttatt
ccacagggttggaccaagttttacgagttttccttatcagatcttcgggctgggtaccac
gtcattgacaggctcttcgatggttccaaagatgtacagtgggaatttgtacatggctta
cttgaaaattctatttatggaggacgtatagataactattttgatcttagagttcttcag
tcctacttgaagcagttttttaattcttcaataattgatgtactaaaccaaaggaataag
aaaagcattttcccatattccatctctctcccagactcgtgcagcattttggactatcgt
gctgtcattgagaagctcccagaggatgacaaacccagcttcttcggtctgcccgccaac
atcgcccgctcctctcagcgcatgaccagttcccaggttatctcccagctcaggatcttg
ggaagatctgtcacagcgggttgcaaatttgacagagaaatctggtcaaatgaactttcc
cccgttctcaatctttggaagaagctgaatcagaattcaaacctaattcatcaaaaagta
tcacctcctaatgatcgacaaggatctccgatattatcattcatcattcttgagcagttc
aatgccatccgcttggttcaaagtgttcatcagtcgcttgctgccctcagcaaagtcatc
aggggaactactttgctgagttcagaagtacaaaagctggcaagtgctttattaaaccag
aagtgtcctctcacatggcagagcaagtgggaaggccccgaggatcccctccagtacctg
cgcggtctcgtagcacgaacacttgcaattcagaattgggtagagaaagctgagaagcaa
gctcttctcgcggatacgcttgacctgtctgagctcttccatcccgacacattcctcaat
gctcttcgccaggaaacggcaagggcaacaggctgctctgtggatagccttaaatttgta
gcatcctggaaaggccgacttcaagaagcaaagctgcagattaagatcagcggtctgtta
ctggaaggctgcagttttgatggcagtcgcctctcagaaaaccagcacgactcccccagc
gtgtcgtcggttcttccgtgctacatgggctggactccgcagggttcttatggtccatat
tcccccgatgaatgcatctctttgcctgtttacacaagtgctgagagggattgtgtggtg
accaacattgatgttccctgtggtggcaaccaggaccagtggatccagtgtggggcagca
ctgtttcttaaaaatcagtaa

DBGET integrated database retrieval system