KEGG   Rattus norvegicus (rat): 66026Help
Entry
66026             CDS       T01003                                 

Gene name
Trpv4, Otrpc4, Vroac
Definition
(RefSeq) transient receptor potential cation channel, subfamily V, member 4
  KO
K04973  transient receptor potential cation channel subfamily V member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
rno04750  Inflammatory mediator regulation of TRP channels
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    66026 (Trpv4)
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    66026 (Trpv4)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    66026 (Trpv4)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   66026 (Trpv4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ank_2 Ank Ank_5 Ank_3 Ank_4
Motif
Other DBs
NCBI-GeneID: 66026
NCBI-ProteinID: NP_076460
RGD: 69337
Ensembl: ENSRNOG00000001195
UniProt: Q9ERZ8
Position
12q16
AA seq 871 aa AA seqDB search
MADPGDGPRAAPGDVAEPPGDESGTSGGEAFPLSSLANLFEGEEGSSSLSPVDASRPAGP
GDGRPNLRMKFQGAFRKGVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGTYRHHPSDN
KRWRRKVVEKQPQSPKAPAPQPPPILKVFNRPILFDIVSRGSTADLDGLLSYLLTHKKRL
TDEEFREPSTGKTCLPKALLNLSNGRNDTIPVLLDIAERTGNMREFINSPFRDIYYRGQT
ALHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHI
VNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCSRLFPDS
NLETVLNNDGLSPLMMAAKTGKIGVFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYD
LSSLDTCGEEVSVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYINVVSYLC
AMVIFTLTAYYQPLEGTPPYPYRTTVDYLRLAGEVITLLTGVLFFFTSIKDLFMKKCPGV
NSLFVDGSFQLLYFIYSVLVVVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTG
TYSIMIQKILFKDLFRFLLVYLLFMIGYASALVTLLNPCTNMKVCNEDQSNCTVPSYPAC
RDSETFSAFLLDLFKLTIGMGDLEMLSSAKYPVVFILLLVTYIILTFVLLLNMLIALMGE
TVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRV
DEVNWSHWNQNLGIINEDPGKSEIYQYYGFSHTMGRLRRDRWSSVVPRVVELNKNSGTDE
VVVPLDNLGNPNCDGHQQGYAPKWRAEDAPL
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcctggtgatggcccccgtgcagcgcctggggatgtggctgagccccctgga
gacgagagtggcacttctggtggggaggccttccccctctcttccctggccaacctgttt
gagggagaggaaggctcctcttctctttcaccagtggatgctagccgccctgctggcccc
ggggatggacgtccaaacctgcgtatgaagttccagggcgctttccgcaagggggttccc
aaccccattgacctgctggagtccaccctgtatgagtcctcagtagtgcctgggcccaag
aaagcgcccatggattcgttgttcgactatggcacttaccggcaccaccccagtgacaac
aagagatggaggaggaaggtcgtagagaagcagccacagagccccaaagctcccgccccc
cagccaccccccatcctcaaagtcttcaaccggcccatcctctttgacatcgtgtcccgg
ggctccactgccgacctggacggactgctctcctacttgctgacccacaagaagcgcctg
actgatgaggagttccgggaaccatccacagggaagacctgcctgcccaaggcacttctg
aacttaagcaatggccgaaacgacaccatcccagtgttgctggacattgcggaacgcacg
ggcaacatgcgggagttcatcaactcgcccttcagagacatctactaccgagggcagacg
gcactgcacatcgccattgaacggcgctgcaagcattacgtggagctcctggtggcccag
ggagccgatgtgcacgcgcaggcccgagggcggttcttccagcccaaggatgagggtggc
tacttctactttggggagctgcccttgtccttggcagcctgcaccaaccagccgcacatc
gtcaactacctgacagagaaccctcacaagaaagccgatatgaggcgacaggactccaga
ggcaacacggtgctccacgcgctggtggccatcgctgacaacacccgagagaacaccaag
tttgtcaccaagatgtatgacctgttgcttctcaagtgctcccgcctcttcccagacagc
aacctggagactgtgcttaacaatgacggtctttcgcccctcatgatggctgccaagact
ggcaagatcggggtctttcagcacatcatccgacgggaggtgacagatgaggacacacgg
cacctgtctcgcaagttcaaggactgggcctacgggcctgtgtattcttctctctacgac
ctctcctccctggatacgtgcggggaggaagtgtccgtgctggagatcctggtttacaac
agcaagatcgagaaccgccatgagatgctggctgtggagcccattaacgaactgctgagg
gacaagtggcgtaagttcggggccgtgtccttctacatcaacgttgtctcctatctgtgt
gccatggtcatcttcaccctcacagcctactatcagccactggagggcacgccaccctac
ccttaccgtaccacggtggactacctgaggctggctggtgaggtcatcacgctcctcaca
ggagtcctgttcttctttaccagtatcaaagacttgttcatgaagaaatgccctggagtg
aattctctcttcgtcgatggctccttccagttgctctacttcatctactcagtgctggtg
gttgtgtctgcggcgctctacctggcagggatcgaggcctatctggctgtgatggtcttt
gccctggtcctgggctggatgaatgccctttacttcacccgtgggctgaagctgacaggg
acctacagcatcatgattcagaagatcctcttcaaagatctcttccgctttctgctggtc
tacctgctttttatgattggctatgcctcagctctggtcaccctcctgaatccgtgcacc
aacatgaaggtctgtaacgaggaccagagcaactgcacggtgccctcataccccgcgtgc
cgggacagcgagaccttcagcgccttcctactggacctcttcaagctcaccatcggcatg
ggcgacctggagatgctgagcagcgctaagtaccccgtggtcttcattctcctgctggtt
acctacatcatcctcaccttcgtgctcctgctgaacatgctcatcgccctcatgggtgag
accgtgggccaggtgtccaaggagagcaagcacatctggaagctgcagtgggccaccacc
atcctggacatcgagcgctccttccctgtgttcctgaggaaggccttccgctccggagag
atggtgacagtgggcaagagctcggatggcactccagaccgcaggtggtgcttcagggtg
gacgaggtgaactggtctcactggaaccagaacctgggcatcattaacgaggaccccggc
aagagcgagatctaccagtactatggcttctcccataccatggggcgcctccgcagggat
cgctggtcctcagtggtgccccgcgtggtggagctgaacaagaactcaggcacagatgaa
gtggtggtccccctggataacctagggaaccccaactgtgacggccaccagcaaggttat
gctcccaagtggagggcggaggacgcaccactgtag

DBGET integrated database retrieval system