KEGG   Rattus norvegicus (rat): 679668
Entry
679668            CDS       T01003                                 

Gene name
LRRTM1
Definition
(RefSeq) leucine rich repeat transmembrane neuronal 1
  KO
K16665  leucine-rich repeat transmembrane neuronal protein 1/2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    679668 (LRRTM1)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 UL97 HemY_N Ni_hydr_CYTB LRR_12
Other DBs
NCBI-GeneID: 679668
NCBI-ProteinID: NP_001102844
RGD: 1585921
Ensembl: ENSRNOG00000006093
UniProt: D4A6D8
Position
4q33
AA seq 523 aa
MDFLLLGLCLHWLLRRPSGVVLCLLGACFQMLPAAPSGCPGQCRCEGRLLYCEALNLTEA
PHNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQKLRRVKELTL
SSNQITELANTTFRPMPNLRSVDLSYNKLQALAPDLFHGLRKLTTLHMRANAIQFVPVRI
FQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLIKVNFAHFPRLISLNSLCL
RRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPYLQSLQLDSNRLTYIEPRIL
NSWKSLTSITLAGNLWDCGRNVCALASWLSNFQGRYDANLQCASPEYAQGEDVLDAVYAF
HLCEDGAEPTSGHLLSAAVTNRSDLAPPESSATTLVDGGEGLHDSTLEPITVAIPGGEHA
ENAVQIHKVVTGTMALIFSFLIVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQ
MAAMSAQEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggatttcctgctactcggcctctgtctacactggctgctgaggaggccctcgggggtg
gtcttgtgtctgctgggggcctgctttcagatgctgcccgccgcccccagcggatgcccg
gggcagtgtcggtgcgaggggcggctgctgtactgcgaggcgctcaacctgaccgaggcg
ccccacaacctgtccggcctgctgggcttgtctttgcgctacaacagcctctcggagctg
cgcgctggccagttcacagggttaatgcagctcacgtggctgtatttggatcacaatcac
atctgctcggtgcagggggacgcctttcagaaactgcgccgagttaaggaactcacactg
agttccaaccagatcaccgaactggccaacaccacctttcggcccatgcccaacctgcgc
agcgtggacctgtcctacaacaagctgcaggcgctagctccggatctcttccacgggctg
cggaagctcaccaccctgcacatgcgggccaatgccattcaattcgtgccggtgcgcatc
tttcaggactgccgcagcctcaagtttctcgacattggatacaatcagctcaagagtctg
gcgcgcaactctttcgccggcttgttcaagctcacagagctacacctggagcataacgac
ttgatcaaggtgaacttcgcccatttcccgcgcctcatctccctgaactcgctctgcctg
aggcggaataaggttgccattgtggtcagctctcttgactgggtttggaatttggagaaa
atggacttgtctgggaacgagatcgaatacatggagccccatgtgttcgagaccgtgccg
tacctgcagtccctacagctggactccaaccgcctcacctacattgagccccgtatcctc
aactcctggaagtcccttacgagcatcactctagccgggaacctgtgggactgcgggcgc
aacgtgtgtgccctggcttcctggctcagcaacttccagggacgttacgatgctaacttg
cagtgcgccagcccggagtacgcacagggcgaggacgtcttggatgcagtttatgctttc
cacttgtgtgaggatggggccgagcccaccagcggccacctcctgtcggcggccgtcact
aaccgcagtgacctagcgccccctgagagctcagccacgactctggtggacggtggggag
gggctgcacgatagcacgcttgaacccatcaccgtggctatccccggcggtgagcacgca
gagaacgcagtgcaaatccacaaggtggtcacgggcacgatggccctcatcttctccttc
ctcatcgtggtcctcgtactttatgtatcctggaagtgtttcccagccagcctcaggcag
ctcagacagtgctttgtcacgcagcgcaggaagcagaagcagaaacagaccatgcatcag
atggctgctatgtctgcccaggaatattatgttgattacaaacccaaccacatcgagggg
gccctggttatcatcaacgagtacggctcgtgtacctgtcaccagcagcctgcgagggaa
tgtgaggtgtga

DBGET integrated database retrieval system