KEGG   Rattus norvegicus (rat): 680006
Entry
680006            CDS       T01003                                 

Gene name
Mad1l1
Definition
(RefSeq) MAD1 mitotic arrest deficient like 1
  KO
K06679  mitotic spindle assembly checkpoint protein MAD1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04914  Progesterone-mediated oocyte maturation
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    680006 (Mad1l1)
   04114 Oocyte meiosis
    680006 (Mad1l1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    680006 (Mad1l1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    680006 (Mad1l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    680006 (Mad1l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    680006 (Mad1l1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     680006 (Mad1l1)
SSDB
Motif
Pfam: MAD TSC22 DUF2856
Other DBs
NCBI-GeneID: 680006
NCBI-ProteinID: NP_001102857
RGD: 1596881
Ensembl: ENSRNOG00000001265
UniProt: D3ZIV3
Position
12q11
AA seq 717 aa
MEDLGENTTVLSTLRSLNNFISQRMEGASGLDVSTSASGSLQKQYEQNMQLEERAEQIRS
KSYLIQVEREKMQMELSHKRARVELERAASTNARNYEREVDRNQELLARIRQLQEREAAA
EEKMREQLERHRLCKQSLDAASQQLREREDGLAAARETISSLKGRVSELQLSAMDQKVQV
KRLESEKQELKEQLELQQRKWQEANQKIQELQASQEERTDQEQKIKDLEQKLCLQEQDAA
VVKSMKSELLRLPRMERELKRLREENTHLREMRETNGLLTEELEGLQRKLGRQEKMQEAL
VDLELEKEKLLAKLQSWEKLDQTMGLNLRTPEDLSRFVIELQQRELALKEKNSSITSSAR
GLEKAQQQLQDEVRQVNAQLLEERKKRETHEALARRLQKRNALLTKERDGMRAILGSYDS
ELTQAEYSPQLTQRMWEAEDMVQKVHAHSSEMEAQLSQALEELGVQKQRADTLEMELKML
RAQTSSAEASFPFCKEEVDALRLKVEELEGERSRLEQEKQALEMQMERLTLQGDYNQSRT
KVLHMSLNPASMARQRQREDHDRLQEECERLRGLVHALERGGPIPADLEAASSLPSSKEV
AELRKQVESAELKNQRLKEVFQTKIQEFRKVCYTLTGYQIDVTTESQYRLTSRYAEHQTD
CLIFKATGPSGSKMQLLETEFSRSVPELIELHLLQQDSIPAFLSALTIELFSRQTSV
NT seq 2154 nt   +upstreamnt  +downstreamnt
atggaagaccttggggagaacaccacagtcctgtccaccctgagatctctcaacaacttc
atttctcagcgaatggagggagcatcaggcttggatgtgtccacatctgcctcagggtcc
ctacagaagcagtatgaacagaacatgcagctggaggagagagcagagcagatccgttca
aagtcctacctcatccaggtggagcgggagaagatgcagatggagctgagccacaagagg
gctcgggtggagctggagagagcggccagcaccaatgccaggaactatgagcgcgaggtg
gatcgcaaccaggaactcctggcacgcattcggcagctccaggagcgtgaggccgcagca
gaagagaagatgcgggagcagctggagcgccacaggctgtgcaagcagagcctggacgct
gccagtcagcagctgcgggaacgagaggatggcctggctgcagccagggagacgattagt
tcattgaaggggcgagtctccgagctgcagttgagtgcgatggaccagaaggtacaggtc
aagcgcctggagtctgagaagcaggagctgaaggagcagctggaactgcagcagcggaaa
tggcaggaggcaaatcagaagatccaggagctacaggccagtcaagaagagagaactgac
caggagcagaagattaaggacctggagcagaagctgtgtctgcaagagcaggatgcagct
gtggtgaagagcatgaaatctgagctgttgcgactgcctcggatggagcgtgagctaaag
aggctgcgtgaggagaacactcatctaagggagatgagggagaccaatgggctgctcaca
gaggagctggaaggtctgcagaggaagctgggccgccaggagaagatgcaggaagctctg
gttgatctggagttggagaaggagaagctgcttgcaaagctgcagagctgggagaaactg
gaccagaccatgggcttgaatctcaggactccagaggacctttcgaggttcgtgattgag
ctgcagcagcgagagctggcgctgaaggagaagaatagcagcatcaccagcagtgcccgg
ggtctggagaaggcccagcagcagctccaggatgaggtccggcaggtcaatgcacagctg
ctggaagagaggaagaagagggagacacatgaggcacttgcccgaaggctccagaagcgc
aatgcattgctgaccaaggagcgagacggcatgcgcgccatcctgggatcctacgacagt
gagctgacccaagctgagtactcgccccagcttacacagcgcatgtgggaggctgaggac
atggttcagaaggtgcatgcccacagctcagagatggaggctcagctgtctcaggccctg
gaagagcttggggttcagaagcagagagctgacacgctggagatggagttgaagatgctg
agggcccagacaagctcagccgaagccagcttcccattctgcaaagaggaggtggatgca
ctcaggttgaaggtggaggagctggagggtgagcggagccgtctggaacaggaaaagcag
gctctggagatgcagatggagagactaaccctacagggtgactacaaccagagtcgaacc
aaagtgctacacatgagcctgaacccggctagcatggccaggcagcgccagcgtgaggac
catgaccggctgcaggaggaatgcgagcgcttacggggacttgtgcatgccctagagaga
ggcggtcccatccctgctgacctggaggctgcctccagcctgccctcatccaaggaggtg
gcagagctgcggaagcaggtagaaagcgctgagctgaagaaccagcggctcaaggaggtt
ttccagaccaagatccaggagttccgcaaggtttgctacacactgaccggctaccagatt
gacgtgaccactgagagccaataccgcctcacctcccgatatgctgagcaccagactgac
tgcctcatcttcaaggccacaggaccctcgggctccaaaatgcagctgctggagacggag
ttctcccgttcagtgcctgagctcattgagctgcacctgctgcagcaggacagcatccct
gccttcctcagcgcgctcaccatagagctgttcagccgccagacctctgtctag

DBGET integrated database retrieval system