KEGG   Rattus norvegicus (rat): 680609
Entry
680609            CDS       T01003                                 

Gene name
Ebi3
Definition
(RefSeq) Epstein-Barr virus induced 3
  KO
K24476  interleukin 27 subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    680609 (Ebi3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    680609 (Ebi3)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   680609 (Ebi3)
SSDB
Motif
Pfam: Interfer-bind fn3 ObR_Ig
Other DBs
NCBI-GeneID: 680609
NCBI-ProteinID: NP_001102891
RGD: 1589467
Ensembl: ENSRNOG00000050509
UniProt: M0RD76
Position
9q12
AA seq 228 aa
MSKLLLLSLALWASCSPGNTGTALVDLSQPRVRCHASRYPVAVDCSWMPLQAPNSTRAMS
FIATYRLGVAAQQQSQPCLQRTPQASRCTIPHVHLFSTVPYLLNVTVVHPGGANSSLLAF
VAERIIKPDPPEGVRLRKAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGP
IEATTFTLRNTQPHAKYCIQVSAQDLTDYGKPSDWSLPGQVERAPQKP
NT seq 687 nt   +upstreamnt  +downstreamnt
atgtccaagctgctcctcctgtcacttgctctctgggccagctgctcccctggtaacact
gggacagcgctagtggatctgagccagcccagagtgcgatgccatgcttctcggtaccct
gtggctgtggactgctcctggatgccactccaggctcccaactccaccagagccatgtcc
ttcattgccacttacaggctcggtgtggccgcccagcagcagagccagccctgcctgcaa
cggaccccccaggcatcccgttgcaccatcccccacgtgcacctgttttccacagtgccc
tacttgctaaatgtcactgtagtgcaccctggcggcgccaacagcagccttctagccttt
gtggcggaacgaatcatcaagcccgaccctccggaaggcgtgcgcctgcgcaaagcggga
cagcgcctgcaggttctctggcatccccctgcttcctggcccttcccggacatcttctct
ctcaagtaccgacttcgctaccggcgccgaggagcctctcacttccgccaggtgggacct
attgaagccacgactttcaccctcaggaacacacaaccccatgccaagtattgcatccag
gtgtcagcccaggacctcaccgattatgggaaaccaagtgactggagcctccctgggcaa
gtagagagggcgccccagaagccctga

DBGET integrated database retrieval system