KEGG   Rattus norvegicus (rat): 680611
Entry
680611            CDS       T01003                                 

Gene name
Bcl3
Definition
(RefSeq) B-cell lymphoma 3 protein
  KO
K09258  B-cell CLL/lymphoma protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04625  C-type lectin receptor signaling pathway
rno04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    680611 (Bcl3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    680611 (Bcl3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    680611 (Bcl3)
   03110 Chaperones and folding catalysts [BR:rno03110]
    680611 (Bcl3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    680611 (Bcl3)
Chaperones and folding catalysts [BR:rno03110]
 Other chaperones and cochaperones
  Others
   680611 (Bcl3)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3
Other DBs
NCBI-GeneID: 680611
NCBI-ProteinID: NP_001102892
RGD: 1589465
Ensembl: ENSRNOG00000043416
Position
1
AA seq 448 aa
MPRCPAGAMDEGPVDLRTRPKGISGAALPLRKRPLRPASPEPAAPRGPAGPLDALRSNCD
VPAVPGPPHCVARPEALYYQGPLMPMYSTPTMAPPFPLLNLPTHPYSMICPVEHPLSADI
AMATRVDEDGDTPLHIAVVQNNKTAVYRILSLFKLGNREVDVHNNLRQTPLHLAVITTLP
DIVRLLVTAGASPMALDRHGQTAVHLACEHRSPSCLQALLDSATPGSVDLEARNYEGLTA
LHVAVNTGCQEAVLLLLERGADIDAVDIKSGRSPLIHAVENNSLNMVQLLLLHGANVNAQ
MYSGSSALHSASGRGLLPLVRTLVRSGADSGLKNCHNDTPLMVARSRRVIDILRGKASRA
ASGSQPDPSPDQSATNSPESSSRLSSNGLQSSPSSSPSLSPPKDAPSFPMTPQNYFLPAT
SAPAFLPFPGVLRGPGRPVAPSPAPGSS
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgccccgatgccccgcgggggccatggacgaggggcccgtggacctacgcacccggccc
aagggcatctcaggcgccgcgctgccactccgcaagcgcccgctgcgtcccgcgtctcca
gagcccgcagccccgcgaggtcctgctggacccctggacgccctgcgcagcaactgcgac
gtcccggctgtccctggaccccctcactgcgtggccaggccggaggctctttactaccag
ggacctctgatgcccatgtactctaccccgactatggccccgccctttccgctgctgaac
ctgcctactcacccctactccatgatttgccccgtggagcaccccctttcagctgacatt
gccatggccacccgggtggatgaggacggagacacgcctctccacattgccgtggtccag
aataacaagacggccgtctaccgaattctcagccttttcaagcttgggaacagggaagtc
gatgtccacaacaacctgcgacagaccccgctccacctggctgtgatcaccacattacca
gatatagtccggctcctggtgacagctggtgccagccccatggccctggatcgccacggt
cagactgcagtccacctggcatgcgagcaccgaagccccagctgcctgcaggccctgcta
gacagcgcaaccccgggctctgtggacctggaggctcgcaattatgaagggctcactgcc
ctgcacgtggccgtgaacaccgggtgccaggaagctgttctgctgctcctggagcgtggc
gcagacatcgatgcagtggatattaagagcggccgctccccactcatccatgctgtggag
aacaacagcctgaacatggtgcaactgctcctgctgcacggcgccaacgtgaacgctcag
atgtactctggcagctcggctctgcattccgcgtctggccgcgggcttctgcctctggtg
cgcacactggtgcgcagcggggctgacagcggcctcaagaactgtcacaatgacacaccc
ctcatggtggcgcgcagccgcagggtcattgatatcctaaggggaaaggcctctcgggct
gcttcagggtcacagcctgatccatccccagaccaaagtgccaccaactcccctgagagc
agcagccgtctcagctccaatggcctccagtcctctccgagctcctcaccctcgctgtct
cccccgaaggatgctccaagcttccccatgactccccaaaactacttccttcctgcaaca
tctgcacctgccttcctgcccttcccaggggtcctccgaggccctggccggcccgtagcc
ccctccccagctccaggaagcagctga

DBGET integrated database retrieval system