KEGG   Rattus norvegicus (rat): 680615
Entry
680615            CDS       T01003                                 

Gene name
Hist1h2ak
Definition
(RefSeq) histone cluster 1, H2ak
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    680615 (Hist1h2ak)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    680615 (Hist1h2ak)
  09165 Substance dependence
   05034 Alcoholism
    680615 (Hist1h2ak)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    680615 (Hist1h2ak)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    680615 (Hist1h2ak)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    680615 (Hist1h2ak)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   680615 (Hist1h2ak)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 680615
NCBI-ProteinID: NP_001102893
RGD: 1589461
Ensembl: ENSRNOG00000052594
UniProt: D3ZVK7
Position
17p11
AA seq 130 aa
MTGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgactggacgtggtaaacaaggtggtaaggctcgtgccaaggccaagacccgctcctcc
cgggccggcctacagttccccgtgggtcgtgtgcaccgtctgctccgcaagggcaactac
tcggaacgggtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg
gccgagatcttggagctggcgggcaacgcggcgagggacaacaagaagacgcgtatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcacagggcggtgtcctgcccaacatccaggcggtgctgctgcccaagaag
accgagagccaccacaaagctaagggaaagtga

DBGET integrated database retrieval system