KEGG   Rattus norvegicus (rat): 682147
Entry
682147            CDS       T01003                                 

Gene name
Cgas
Definition
(RefSeq) cyclic GMP-AMP synthase isoform X1
  KO
K17834  cyclic GMP-AMP synthase [EC:2.7.7.86]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04623  Cytosolic DNA-sensing pathway
rno05163  Human cytomegalovirus infection
rno05168  Herpes simplex virus 1 infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    682147 (Cgas)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    682147 (Cgas)
   05171 Coronavirus disease - COVID-19
    682147 (Cgas)
   05168 Herpes simplex virus 1 infection
    682147 (Cgas)
   05163 Human cytomegalovirus infection
    682147 (Cgas)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.86  cyclic GMP-AMP synthase
     682147 (Cgas)
SSDB
Motif
Pfam: Mab-21 RasGAP_C Spc29
Other DBs
NCBI-GeneID: 682147
NCBI-ProteinID: XP_038938458
RGD: 1586939
Position
8
AA seq 510 aa
MEDPRRRTTAPRAKKPSAKRAPTRPSGTRATVSHAGSCGPQRGARSRRVERDGDTTEKPH
TPAPRVRPRRAAERTEDAQPLATDAAGASERPAVREPQRQVILDPEPPAVPEPQAPEDPE
APTVARGPVRRRGARSIRQPRASQGSRKEPDKLKKVLDKLRLKRKEISAAAETVNKVVDQ
LLRRMQRRESEFKGVEQLNTGSYYEHVKISAPNEFDVMFKLEVPRIELEEYYETGAFYRV
KFKRIPRGNPLSHFLEGEVLSATKVLSKFRELIKEEVKEIKDTDVTVEEEKPGSPAVTLL
IRNPEEISVDIILALESKGSWPISTKGGLPIQDWLGTKVRTNLRREPFYLVPKNAKDGNR
FQGETWRLSFSHTEKYILNNHGIGKTCCESSGAKCCRKECLKLMKYLLEQLKREFQELDA
FCSYHVKTAIFHMWTKDPQDSQWDPRNLSTCFDKFLTFFLECLRTEKLDHYFIPKFNLFS
QELIDKKSKEFLSEKIEYERNNGFPIFNKF
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggaagatccgcgtagaaggacgacggcgccgcgcgctaagaagccgtctgcgaagcgc
gccccgacgcggcccagcggaacccgggccaccgtgtcccacgcgggaagctgcggcccg
caaagaggggcgcgatcgcgacgggtggagcgtgacggggacaccacggagaagccacac
accccagcgccccgagtgcgtcccagaagggccgctgagcgcaccgaggatgcacagccc
ttggccacggacgcggctggagcctccgagaggcccgcggtccgggagccccagcggcaa
gtcatcctcgatcctgagccgcccgctgtgccggagccccaggcgcccgaggatcccgag
gcgccgactgtcgcaaggggacctgtccgcagaaggggcgcacgctccatccggcagccc
agagcgtcgcaagggtccaggaaggagccagacaagctaaagaaggtgctggacaaattg
agattgaaacgcaaagaaatctcggcggcggccgagacggtgaataaagtcgtggatcaa
ctgctgcgcagaatgcagagacgggagtccgagttcaaaggcgtggagcagctgaacacc
ggcagctattatgaacatgtgaagatttctgctcctaatgaatttgatgttatgtttaaa
ctggaagtccccagaatcgagctagaagaatattacgaaactggtgctttctatcgtgtg
aagttcaagagaattccacgaggaaatcctctgagtcattttttagaaggggaagtatta
tcagctaccaaggtgctgtcaaagtttagggaactcattaaagaagaagtgaaagagatc
aaagatacagatgtcaccgtggaggaggaaaaaccaggaagccctgctgtaacccttctc
atcaggaaccctgaagaaatatctgtggatataatcctggctttggaatcgaaaggcagc
tggcctattagtaccaaaggaggactacctattcaagactggctcggcacaaaagtgagg
accaatctaagacgagagccgttttatcttgtacccaagaatgcaaaagatggaaatcgt
tttcaaggagagacatggcgcctctccttctctcacactgaaaaatacattttgaataat
catgggataggaaaaacatgttgtgaatcttctggagcaaaatgttgcaggaaagaatgt
ttaaaattaatgaaataccttttggaacagttgaaaagagagtttcaagagctagatgca
ttctgttcttaccacgtgaaaactgccatctttcatatgtggaccaaggacccacaggac
agtcagtgggaccccaggaacctaagcacctgctttgataagtttttgacattcttcctg
gagtgcctcaggacagagaaactggaccactattttattccaaagtttaatctgttttct
caagagctaattgacaaaaaaagtaaagaatttctgtcagagaaaatcgaatatgaaaga
aacaatggatttccaattttcaacaagttttga

DBGET integrated database retrieval system