KEGG   Rattus norvegicus (rat): 683206
Entry
683206            CDS       T01003                                 

Gene name
Tnfaip3
Definition
(RefSeq) tumor necrosis factor alpha-induced protein 3 isoform X1
  KO
K11859  tumor necrosis factor, alpha-induced protein 3 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04217  Necroptosis
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05162  Measles
rno05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    683206 (Tnfaip3)
   04668 TNF signaling pathway
    683206 (Tnfaip3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    683206 (Tnfaip3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    683206 (Tnfaip3)
   04657 IL-17 signaling pathway
    683206 (Tnfaip3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    683206 (Tnfaip3)
   05169 Epstein-Barr virus infection
    683206 (Tnfaip3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    683206 (Tnfaip3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    683206 (Tnfaip3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     683206 (Tnfaip3)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C64
   683206 (Tnfaip3)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    683206 (Tnfaip3)
SSDB
Motif
Pfam: zf-A20 OTU
Other DBs
NCBI-GeneID: 683206
NCBI-ProteinID: XP_038954753
RGD: 1589275
Ensembl: ENSRNOG00000049517
Position
1
AA seq 814 aa
MTRSNTGVSCRQVYGSSVKGRLTEWAFPLPLQALSRTMAEQLLPQALYLSNMRKAVKIRE
RTPEDIFKPSNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRSVQASLESQKKL
NWCREVRKLVALKTNGDGNCLMHAACQYMWGVQDTDLVLRKALCSTLKETDTRNFKFRWQ
LESLKSQEFVETGLCYDTRNWNDEWDNLVKMASADTPAARSGLQYNSLEEIHIFVLSNIL
RRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSQHFVPLVTL
KDSGPEIRAVPLVNRERGRFEDLKVHFLTDPEHEMKEKLLKEYLMVLEIPVQGWDHGTTH
LINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENGDQGRRGAHAQNPLEASTPQLSLM
DIKCETPNCPFFMSVNTQPLCHECSERRQKNQSKLPKLNSKLGPEGGLPAVGLGSSNWNP
EETAGGPHSAPPTAPSLFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQMSASHTA
DPGKCQACLQDVTRTFNGICSTCFKRTTAEPTSSLTSSVPPSCHQRSKSDPSQLIQSLTP
HSCHRTGNAVPSGYLSQTSRTPADRTGTSKCRKAGCMYFGTPENKGFCTLCFIEYRENKQ
SVTASGKAASSAPRFQNNIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRPEEQL
RSSQRREMPRTTQGASRPKCARASCKNILACRSEELCMECQHLSQRIASLAHRGEPTPEE
PPKQRCRAPACDHFGNAKCNGYCNECYQFKQMYG
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgacaagatcaaacactggggtttcctgccggcaggtatatgggagcagtgtaaaaggc
aggctaacggaatgggcttttccccttcctcttcaggccttgtcgaggaccatggctgaa
caacttcttcctcaggctttgtatttgagcaatatgaggaaagcggtgaagatacgagag
agaaccccagaagacattttcaagcctagcaatgggatcatccaccattttaaaaccatg
caccggtacacactggagatgttcagaacgtgtcagttttgcccacagtttcgagagatc
atccacaaagcacttattgacagaagcgtccaggcttctctggaaagccaaaagaagctc
aactggtgtcgtgaagtcaggaagctcgtggctctgaaaaccaacggtgatggaaactgc
ctcatgcatgcagcctgtcagtatatgtggggtgtccaggatactgacttggtcctgagg
aaggccctctgcagcacccttaaggagacagacactcggaattttaagttccgctggcag
ctggagtcgctgaaatctcaggaatttgtggagacgggactttgctacgacactcggaac
tggaatgacgaatgggacaacttggtcaaaatggcctcagcagacacaccagcagcccgg
agtggacttcagtacaattctctggaagaaatccacatatttgtcctcagcaacatcctc
agaagacccatcattgtcatctcagacaaaatgctaagaagtttggaatcaggttccaat
tttgctcctttgaaagtgggtgggatctacctgcctctccactggcctgcgcaggaatgt
tacagatatcccatcgtccttggctacgacagtcagcactttgtacccctggtgaccctg
aaggacagtggccctgaaattcgagctgttccacttgttaacagagagcggggtaggttt
gaagacttgaaggttcactttttgacagaccctgaacatgagatgaaggaaaagcttctc
aaggagtacttgatggtgctggagatcccggtgcaaggctgggaccacggcacgactcac
ctgatcaatgctgccaagttagatgaagctaatctacccaaagaaataaatctggtagac
gactacttcgagcttgttcagcacgaatacaagaagtggcaagaaaacggcgatcagggc
aggagaggggcgcatgcgcagaaccctttggaggcttccacaccccagctatcactcatg
gatataaaatgtgagacgcccaactgtcctttcttcatgtccgtcaacactcagccttta
tgccacgagtgctccgagaggcgtcaaaagaaccagagcaaactcccaaagctgaactcg
aagctgggccctgagggaggactcccagcggtgggacttggctcctcgaactggaacccc
gaggaaacagctggaggcccccattcggccccacccacggcccccagccttttcctgttc
agtgagaccactgcaatgaagtgcaggagccccgggtgccctttcacgctgaacgtgcaa
cacaacggattctgtgagcgttgtcacaatgcgcggcagatgagcgccagccacaccgca
gaccccggtaagtgccaagcctgccttcaggatgtcactcggacgtttaacggcatctgt
agtacctgtttcaaaaggactacggcagagcccacctccagcctcacttccagtgtccct
ccctcctgtcaccagcgctccaagtctgacccctcacaactcatccaaagtctcacccca
cactcttgccaccgaactggaaatgccgtcccctctggctacctttcccagacatcacgg
actccagcagacagaactgggacaagcaagtgcagaaaagctggctgcatgtattttggg
actccggaaaacaagggcttttgcacgctatgtttcatcgaatacagagaaaataaacag
tctgtcaccgcctctgggaaagccgcttcctcggcccccagattccagaacaacatcccg
tgcctgggcagggagtgtggcaccctgggaagcaccatgtttgaagggtactgtcagaag
tgtttcattgaagctcagaaccagagatttcatgaagccaaaaggcctgaagaacaactg
agatcaagccagcgtagagaaatgcctcgaaccacacagggagcctcaaggccgaagtgt
gcccgggcctcttgcaagaacatcctggcttgtcgcagtgaggaactctgtatggagtgc
cagcacctaagccagcgaatagcttctttggcccaccggggtgagcccactcctgaagag
ccccctaagcagcgctgccgggcccctgcttgcgatcactttggcaatgccaagtgtaat
ggttactgcaatgagtgctaccagttcaagcagatgtacggctaa

DBGET integrated database retrieval system