KEGG   Rattus norvegicus (rat): 684173
Entry
684173            CDS       T01003                                 

Gene name
Traf5
Definition
(RefSeq) TNF receptor-associated factor 5
  KO
K09849  TNF receptor-associated factor 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04217  Necroptosis
rno04621  NOD-like receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05163  Human cytomegalovirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    684173 (Traf5)
   04668 TNF signaling pathway
    684173 (Traf5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    684173 (Traf5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    684173 (Traf5)
   04657 IL-17 signaling pathway
    684173 (Traf5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    684173 (Traf5)
   05203 Viral carcinogenesis
    684173 (Traf5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    684173 (Traf5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    684173 (Traf5)
   05168 Herpes simplex virus 1 infection
    684173 (Traf5)
   05163 Human cytomegalovirus infection
    684173 (Traf5)
   05169 Epstein-Barr virus infection
    684173 (Traf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    684173 (Traf5)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    684173 (Traf5)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-TRAF_2 zf-C3HC4_4 Sina zf-RING_UBOX zf-RING_2 zf-RING_6 DUF5917 TFA2_Winged_2 DUF4279 SBD_N Fez1 Med4
Other DBs
NCBI-GeneID: 684173
NCBI-ProteinID: XP_038947438
RGD: 1593883
Position
13
AA seq 558 aa
MAHSEEQAVVPCAFIRQNSGNSISLDFEPDTEYQFVEQLEERYKCAFCHSVLHNPHQTGC
GHRFCQHCILSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARI
ILGRFQDHLQHCSFQAVPCPNQSCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNL
QDHEENSCPAYPVSCPNKCVQTIPRAGVKEHLTVCPEAEQDCPFKHYGCTVKGKRGNLQE
HERAALQDHMLLVLEKNFQLEQQISDLYQSLEQKESKIQQLAGTVKKFEKELKQFTQMFG
RNGSFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQQSRLDLRSLVDAVDSVKQRITQLE
ASDQRLVVLEGETNKHDAHINIHKAQLNKNEERFKLLEGACYSGKLIWKVTDYKAKKREA
MEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNHIVETFKADPNSSSFRRPDGEMNIASGCPRFVSHSTLESSRNTYIK
DDTLFLKVAVDLTDLEDL
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggctcattcagaggagcaagcggttgtgccctgtgccttcatccgccagaactctggc
aactccatttccttggactttgagcccgacacagagtaccaatttgtggagcagctggaa
gaacgctacaaatgtgccttctgccactcggtgcttcacaacccccaccagacgggctgt
gggcaccgcttctgccagcactgcatcctgtctctgagagaattgaactcggtgccgatc
tgccccgtagacaaggaggtgatcaagcctcaggaggtgtttaaagacaactgctgcaaa
agagaagttctcaacttacacgtctactgcaaaaacgcacctggatgcaatgccaggatt
attctgggacggttccaggaccaccttcagcactgctccttccaagctgtgccctgcccc
aaccagagctgccgggaagccatgctccggaaagatgtgaaagagcatctgagtgcctac
tgccggttccgagaggagaagtgcctttactgcaagagggacatagtggtgactaacctg
caggatcatgaggaaaactcgtgtcctgcatatccagtgtcttgtcccaacaagtgtgtg
cagactattccgagagctggggtgaaggaacacctcactgtgtgccctgaggctgagcaa
gactgtccctttaagcactatggctgcacggtcaagggcaagcgtgggaacttgcaggag
cacgagcgggcagccctgcaggaccacatgcttctggttttagagaagaacttccaacta
gaacagcagatctctgacttatatcagagtctcgagcagaaagaaagcaagatccagcag
cttgcaggaactgtgaagaagttcgagaaagagcttaagcagttcacacagatgttcggc
agaaatggaagtttcctctcaaatgtccaggctctcaccagtcacacggacaagtcggct
tggctggaagcgcaggtgcggcagctgctacaaatagttaaccagcagcaaagccggctt
gatctgaggtctttggtggatgctgtggacagtgtgaaacagaggatcacccagctggag
gccagtgaccagagattagttgttttagagggggagaccaataagcacgacgcacacatt
aatatccacaaagcacagctgaataagaacgaagaacggtttaagctgctggagggcgcc
tgctacagtggcaagctcatttggaaggtgacagattacaaggcgaagaagagggaggct
atggaggggcacacagtgtccgtcttcagccagcctttctataccagccgctgtggctac
cggctctgtgccagagcgtacctgaacggggatgggtcggggaagggaacgcacctgtct
ttgtactttgtggtgatgcggggtgagttcgactcactattacagtggccattcaggcag
agggtgacactaatgcttttggatcagagtggcaagaagaaccacattgtggagaccttc
aaagctgaccccaatagcagcagcttcagaagaccggacggggagatgaacattgcctct
ggctgtccccgctttgtttctcattctactctggagagttccaggaacacctacattaaa
gacgacaccctattcttgaaagtggccgtggatttaactgacttggaggatctgtaa

DBGET integrated database retrieval system