KEGG   Rattus norvegicus (rat): 684558
Entry
684558            CDS       T01003                                 

Gene name
Upf1
Definition
(RefSeq) UPF1, RNA helicase and ATPase
  KO
K14326  regulator of nonsense transcripts 1 [EC:3.6.4.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    684558 (Upf1)
   03015 mRNA surveillance pathway
    684558 (Upf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    684558 (Upf1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     684558 (Upf1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     684558 (Upf1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     684558 (Upf1)
SSDB
Motif
Pfam: UPF1_Zn_bind AAA_12 AAA_11 DUF5599 AAA_30 AAA_19 ResIII DUF2075 Helicase_RecD ATPase SRP54 UvrD-helicase UvrD_C_2 DEAD AAA_10
Other DBs
NCBI-GeneID: 684558
NCBI-ProteinID: XP_001070971
RGD: 1589127
Ensembl: ENSRNOG00000020134
Vega: OTTRNOG00000001982
UniProt: F1LY19
Position
16p14
AA seq 1113 aa
MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGAGGPGGA
GAGGAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPVHACSY
CGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYN
CGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKI
PSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNI
FGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAFFTLPKTDSDMRLMQGDEICLR
YKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQS
ALKTFAVDETSVSGYIYHKLLGHEVEDVVIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQR
PLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLC
AKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERE
LLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQ
LGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGV
TAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGA
KPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRAN
EHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLSYYKEQKALVEGPLNN
LRESLMQFSKPRKLVNTVNPGARFMTTAMYDAREAIIPGSVYDRSSQGRPSNMYFQTHDQ
ISMISAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPKSKTGRGGRQKNRF
GLPGPSQTTLPNSQASQDVASQPFSQGALTQGYVSMSQPSQMSQPGLSQPELSQDSYLGD
EFKSQIDVALSQDSTYQGERAYQHGGVTGLSQY
NT seq 3342 nt   +upstreamnt  +downstreamnt
atgagcgtggaggcgtacggccccagctctcagacactcaccttcttggacactgaggag
gccgagctgctcggtgccgacacccagggctccgagttcgagttcaccgacttcacccta
cccagccagacgcagacgccccccggcggccccggcggcgcgggaggcccaggcggagcg
ggtgcaggcggcgcggccggccagctcgacgcgcaagttggaccagagggcatcttgcaa
aatggggctgtggatgacagtgtggccaagaccagccagctgctggctgagctgaacttc
gaggaagatgaagaggacacatattataccaaggacctcccagtccatgcctgcagttac
tgcggaatccatgatcctgcctgcgtggtttactgtaataccagcaagaagtggttctgc
aacggccgaggaaatacttctggcagccacattgtaaatcacctcgtgagggcaaaatgc
aaggaagtgacgctgcacaaggacgggcccctgggtgagacagtactggagtgctacaac
tgtggctgccggaacgtcttcctgctgggcttcatccctgcgaaggcggactctgtggtg
gtgctgttgtgcaggcagccctgcgccagccagagcagcctgaaggacatcaactgggac
agctcccagtggcagcccctgatccaggaccggtgcttcctgtcatggctggtcaagatt
ccctctgagcaggagcagctgcgagcacgacagatcactgcacagcagatcaacaagctg
gaggagctctggaaggaaaatccttcagcaaccctggaggatctggagaagccgggcgtg
gatgaggagccgcagcacgtgctcctgcggtacgaggatgcttaccagtaccagaacatc
ttcgggccactggtcaagctggaggctgactatgacaagaagttgaaggagtcacagact
caagataacatcacggtcaggtgggacctgggccttaacaagaagagaatcgccttcttc
actttgcccaagactgactctgatatgcggctgatgcagggggatgagatctgtctgcgg
tacaaaggggatctggcacccctatggaaggggattggccacgtcatcaaggttcccgat
aattatggtgatgagattgccattgaactccgcagtagcgtgggtgcccccgtggaagtg
acccacaacttccaagtggattttgtgtggaagtcaacctcttttgataggatgcagagt
gcattgaagaccttcgctgtggacgagacctctgtgtcagggtatatttaccacaagctg
ctgggccacgaggtggaagatgttgtcatcaagtgccagctgccaaagcgcttcacggct
caggggctccccgacctcaaccactctcaggtgtatgctgtgaagactgtgctgcagaga
cccctcagcctcatccagggccctccaggcacaggcaagactgtgacatcagccaccatt
gtctaccaccttgctcggcagggcaatgggcccgtgctagtctgtgctccaagtaacatt
gccgtggaccagctcacggagaagatccaccagactgggctgaaggtcgtacgcctctgt
gccaagagccgtgaggccattgattccccagtgtccttcctggctttgcacaaccagatc
aggaacatggacagcatgcctgagctgcagaagctgcagcagctgaaggatgagacaggc
gagctgtcatctgcagatgagaagcggtaccgggcgcttaagcgcacagctgagagagaa
cttctcatgaatgcagatgtcatctgctgcacatgtgtgggtgctggtgacccgaggctg
gccaagatgcagttccgttccatcctcattgacgagagcacccaggccactgagcctgag
tgcatggtgcctgtagtccttggggccaagcagctgatcctcgtgggtgaccactgccag
ctgggcccagtagtgatgtgcaagaaggcagccaaggccgggttgtctcaatcgctcttc
gagcgcttggtggtgctgggcatccggcccatccgcctgcaggtgcaataccgcatgcac
cctgcactcagcgccttcccgtccaacatcttctacgagggctcgctgcagaatggcgtc
actgcagccgatcgtgtcaagaaaggttttgacttccagtggccacagcctgacaagccc
atgttcttctacgtgacacagggccaggaggagattgccagctctggcacatcctacctc
aacaggacggaggcagccaatgtggagaagataacgacaaagctgctgaaggcaggcgcg
aagcctgaccagattggcatcatcactccctacgagggccagcgctcctacttggtgcag
tacatgcagttcagcggctccctgcacacgaagctctaccaggaagtggagattgcaagc
gtggatgccttccagggccgggagaaggacttcatcatcctgtcctgcgtgcgtgccaat
gagcaccagggtattgggttcttaaacgacccccggcgtctcaatgtggctctcaccaga
gcaaggtacggggtgatcatcgtgggtaacccaaaggcactgtcgaagcagcccctgtgg
aaccacctgctgagctactacaaggagcagaaggcgctggtggaagggccgctcaacaac
ctgcgggagagcctcatgcagttcagcaagcctcgcaagcttgtcaacaccgtcaatccg
ggggcccgcttcatgactactgccatgtatgatgcccgtgaggctatcatccccggatct
gtctatgaccgcagcagccagggccggccctcaaacatgtacttccagacccatgaccag
attagcatgatcagcgcaggtcccagccatgtggctgccatgaacatccccattcccttc
aacttggtcatgcctcccatgccaccacctgggtacttcggacaggccaacgggccagct
gctggtcggggcaccccaaaaagcaagactggccgtggaggccgccagaagaaccgcttt
gggcttcctgggcccagccagactacccttcccaacagccaggccagccaggatgtggcc
tcacagcccttttcgcagggtgccctcacacaaggttatgtgtccatgagccagccctct
cagatgagccagcctggcctctcccagccagaattgtcccaggacagctacctcggtgat
gagtttaaatcacagattgacgtggcactctcacaagactccacataccagggagagcgg
gcataccagcacggcggggtcaccgggctgtcccagtactag

DBGET integrated database retrieval system