KEGG   Rattus norvegicus (rat): 685909
Entry
685909            CDS       T01003                                 

Gene name
H2afv, H2A.Z-2
Definition
(RefSeq) H2A histone family, member V
  KO
K11251  histone H2A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno05034  Alcoholism
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    685909 (H2afv)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    685909 (H2afv)
  09165 Substance dependence
   05034 Alcoholism
    685909 (H2afv)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    685909 (H2afv)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    685909 (H2afv)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    685909 (H2afv)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   685909 (H2afv)
SSDB
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 685909
NCBI-ProteinID: NP_001099489
RGD: 1587865
Ensembl: ENSRNOG00000052275
UniProt: D4AEC0
Position
14q21
AA seq 128 aa
MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTA
NT seq 387 nt   +upstreamnt  +downstreamnt
atggctggaggcaaagctggaaaagacagcgggaaggccaaggctaaggcagtgtctcgc
tcacagagagctgggctccagtttcctgtgggccgcatccacagacacttgaagactcgc
accacaagccatggacgggtgggcgccactgctgctgtgtacagtgctgcaattctggag
tacctcacagctgaggtgttggagttggcaggtaatgcttctaaagatctcaaagtaaag
cgcatcaccccacgtcacttacagcttgcaatccgaggtgacgaagagttggattcactg
atcaaggctaccatagccgggggcggtgtgattccgcacatccacaagtctctgatcgga
aagaaggggcagcagaaaactgcttag

DBGET integrated database retrieval system