KEGG   Rattus norvegicus (rat): 686412
Entry
686412            CDS       T01003                                 

Gene name
Sall4
Definition
(RefSeq) spalt-like transcription factor 4
  KO
K19871  sal-like protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    686412 (Sall4)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    686412 (Sall4)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-met zf-C2H2_6 zf-Di19 DUF3268 TDBD DUF2225 zf-C2H2_11
Other DBs
NCBI-GeneID: 686412
NCBI-ProteinID: XP_001074001
RGD: 1597672
Ensembl: ENSRNOG00000050035
UniProt: M0RDM1
Position
3q42
AA seq 1070 aa
MSRRKQAKPQHINSEEGQGEQPLQQPSPGLAEAPAAEEPGVPVNSSGNGDEASEDPAPAP
VKRSRREDTHICNKCCAEFFSLSEFMEHKKSCTKNPPVLIMNDSEGAVPPEDFSRAVLGS
PSNKDGLQENGGSSSGDLKENLGTDSILYLKTEATQPPAPQDISYLPKGKVANTNVTLQA
LRGTKVAVNQRSTDVPAAPVPAALSIPWILEQILCLQQQQLQQIQLTEQIRVQVNMWAAH
ALHSGVAGADTLKALSNHVSQQVSVSQQVSAAVALLSQKASNPTLSLDALKQAKLPHAAV
PSTASSLSSGFTPFALKPDGTRVLPNFMSRLPNALLPQTPGSVLLQSPFSTVTLDQSKKG
KGKPQNLSASMLDAKTKDEVVLGKHKCRYCSKVFGTDSSLQIHLRSHTGERPYVCPVCGH
RFTTKGNLKVHFHRHPQVKANPQLFATEFQDKGASSTSPHYALPVPIPVDESSLSVDTEP
VPVTGTPSIGLPQKLTSGPNPKDLMGGSLPNDIQPGPSPESEVGLPLLGAGMMRNPPRAG
GFQGTGAPESGSETLKLQQLVENIDKATTDPNECLICHRVLSCQSSLKMHYRTHTGERPF
QCKICGRAFSTKGNLKTHLGVHRTNMAVKTQHSCPICQKKFTNAVMLQQHIRMHMGGQIP
NTPLPESPCDFTVPEPMAVSENGGGSGVCQEDAVEGMEAEEACIQDVPGGPSTVSAPLPG
THLASPSLGFPVMAPLDAQGRGALPALALQRQSSRESGSLEAGDSCLTNDSSSLMGDQEC
PSRSPDATETMCYQAVSPANSQAGSVKSRSPDGHKAEGVESCRVDTEGRTSLPSTFIRAQ
PTFVKVEVPGSFVGPPSVPSGMTPLLASQQPPRRQAKQHSCTRCGKNFSSASALQIHERT
HTGEKPFVCNICARAFTTKGNLKVHYMTHGTNNNSARRGRKLAIENTMAALGAEGKRAPE
VFPKELLSPTVSVDPATWNQYTSVLNGGLAMKTNEISVIQSGGIPTLPVSLGASSVVSNP
TLSKLDGSQTGGSGAMSGAMSGNLEKPGVPDGVAKHQFPHFLEENKIAVS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtcgaggcgcaagcaggcgaagccccagcacatcaactcggaggagggccagggcgag
cagccgctgcagcaaccgagccctggcctcgcagaggcgccggcggcggaggaacccggt
gttccagtgaattcctcagggaacggagatgaagcctcggaggaccccgcccccgccccg
gtgaagcggtcccgacgggaggatactcacatctgtaacaagtgctgtgcggagttcttc
agtctctctgagttcatggaacacaagaaaagttgcactaagaaccctcctgtcctcatc
atgaatgacagcgagggggctgtgcctccagaggacttttccagagctgtcctgggcagc
ccaagcaataaagatggtctccaggagaatggcggcagcagctcgggggacttgaaggag
aacctaggcacggactccatcctgtacttgaagacagaggcgacccagccacccgcaccc
caggacataagctatttgcccaaaggcaaagtagccaacaccaatgtgactctgcaagcg
ctccgtggcaccaaggtggcagtgaaccagcggagcaccgatgtccccgcggcccccgtg
cctgccgctctcagcatcccttggatcctggagcagatcttgtgcctgcagcagcagcag
ctccagcagatccagctaacggaacagatcagagtccaggtgaacatgtgggccgcgcat
gccctccactctggcgtggcaggcgcggacactctcaaggccttaagcaaccacgtgtct
cagcaggtctctgtctcccagcaggtgtctgctgctgtggccctgcttagccagaaagcc
tccaacccaactctgtctctagatgccttgaaacaagccaagctacctcatgccgctgtc
ccctccacggccagctcattgtcctcggggttcacacccttcgccttgaagccggacggg
actcgagttctccccaacttcatgtcccgcctcccgaatgccctgctacctcagaccccg
ggctctgtgctcctgcagagtcccttctctactgtgacactggaccagtccaagaaagga
aaggggaaaccccaaaacctctccgcctccatgttagatgccaagaccaaggacgaggtt
gtcctcggtaagcacaagtgtaggtactgtagtaaggttttcgggaccgatagctccctt
cagattcatcttcgctcccacaccggagagagaccttacgtgtgccctgtctgtggtcac
cgcttcaccaccaagggcaacctcaaggtccacttccatcgacaccctcaggtgaaggcg
aacccccagctgtttgccactgaattccaggacaaaggggcatcaagcaccagtcctcac
tatgcactccctgtccccatccctgtagacgagtcaagtctctctgtagacactgagcct
gtcccggtcacgggaaccccttccatagggctacctcagaagctcacttcagggcctaac
cccaaggacctcatgggcggctccttgcccaacgacatacagccagggccttctccagaa
agcgaggtgggccttccactcctcggggcggggatgatgcgtaatcccccaagggctggg
ggcttccagggcactggagccccagagtcagggtcagagaccctgaagttacagcagcta
gtggagaacatagacaaggccaccaccgaccccaacgagtgtctcatttgtcatcgggtc
ctcagctgtcagagttcccttaagatgcattaccgtacccacacaggagagagaccattc
caatgcaagatctgtggccgggccttctccaccaaaggcaacctgaagacacatcttggg
gttcaccgaacaaacatggccgtaaagacccagcattcgtgccccatctgccagaagaag
ttcaccaatgccgtcatgttacagcagcatatccggatgcacatgggtggccagatcccc
aacacgcctctgcccgagagtccctgcgacttcacagttcccgagcccatggccgtcagt
gagaacggcggtggcagcggtgtctgccaggaagacgcggtagaagggatggaagcggag
gaggcttgtatccaggatgttcccggtggcccctcgacggtctccgcgccgctccccgga
acccatctggcgtcgccctccctgggctttccggtgatggctcccctggatgctcagggg
agaggggctcttcctgctttggccttgcaacggcagagcagtcgagaaagcggctctctg
gaggccggtgacagttgcctgaccaatgactcttcctcgctcatgggtgaccaggagtgt
ccgagccggagcccagatgccacggagaccatgtgctaccaggcagtgtcccctgccaat
agccaagctggaagtgtcaagtcccggtctcccgacggtcacaaggccgagggtgtcgag
agctgccgcgtggacaccgaaggccgtaccagcctcccctcgacatttatccgagcacag
cccacctttgtcaaagttgaagtacctggctcctttgtgggacccccgagcgtgccctca
ggcatgacgcctctgctagcttcccagcagccgccgcgccgccaggccaagcaacactct
tgcacccggtgcgggaagaacttctcgtccgccagtgccctgcagatccacgagcgaacg
cacacgggagaaaagcctttcgtgtgtaacatatgtgctcgggccttcaccacgaaaggc
aacctgaaggtacactacatgactcatgggaccaacaataactccgcccgccgaggcagg
aagctggccatagagaataccatggccgccctgggtgctgagggaaagagagcacctgag
gtgtttcccaaggagctcctgtcccccacggtgagtgtggaccctgccacgtggaaccag
tacaccagtgtcctcaatgggggtctggccatgaagaccaatgagatctctgtgatccag
agtggagggatccccaccctgcctgtgtctctgggggccagctccgtggtgagcaacccc
acgctttctaagctggatggctcccagaccggcgggagcggggccatgagtggggccatg
agcgggaacctagagaagcctggcgttcccgatggggtggccaaacaccagtttcctcat
tttctggaggaaaataagatcgcagtcagctaa

DBGET integrated database retrieval system