KEGG   Rattus norvegicus (rat): 688785Help
Entry
688785            CDS       T01003                                 

Gene name
Trim8
Definition
(RefSeq) tripartite motif-containing 8
  KO
K12001  tripartite motif-containing protein 8 [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    688785 (Trim8)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     688785 (Trim8)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    688785 (Trim8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_4 zf-C3HC4 zf-RING_UBOX zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 zf-B_box zf-RING_5 zf-RING_10 zf-Nse dCache_2 DUF3287
Motif
Other DBs
NCBI-GeneID: 688785
NCBI-ProteinID: NP_001121555
RGD: 1585223
Ensembl: ENSRNOG00000019968
UniProt: D3ZQE3
Position
1q54
AA seq 551 aa AA seqDB search
MAENWKNCFEEELICPICLHVFVEPVQLPCKHNFCRGCIGEAWAKDSGLVRCPECNQAYN
QKPGLEKNLKLTNIVEKFNALHVEKPPTALHCVFCRRGPPLPAQKVCLRCEAPCCQSHVQ
THLQQPSTARGHLLVEADDVRAWSCPQHNAYRLYHCEAEQVAVCQYCCYYSGAHQGHSVC
DVEIRRNEIRKMLMKQQERLEEREQDIEDQLYKLESDKRLVEEKVSQLKEEVRLQYEKLH
QLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGSLQLLFDKTEDVSFMK
NTKSVKILMDRTQTCTGSSLSPPKIGHLNSKLFLNEVAKKEKQLRKMLEGPFSTPVPFLQ
SVPLYPCGVNSSGAEKRKHSTAFPEASFLETSSGPVGSQYGAAGPASSEGQSGQPLGPCS
STQHLVALPGGAQPVHSSPVFPPSQYPNGSATQQPMLPQYGGRKILVCSVDNCYCSSVAN
HGGHQPYPRSGHFPWTVPSQEYSHPLPPTPSVPQSLSGLAVRDWLDASQQPGHQDFYRVY
GQPSTKHYVTS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaattggaagaactgctttgaggaggagctcatctgccccatctgcctgcac
gttttcgtggaaccggtgcagctgccgtgcaaacacaacttctgccggggctgcatcggc
gaggcttgggccaaggacagtggccttgtgcgttgcccggagtgcaaccaggcctacaat
cagaagccgggcctggagaagaacctgaagctcaccaacatcgtggagaagttcaacgcc
ctgcacgtggagaagcccccgacggcactgcactgcgtgttctgtcgccgcggccccccg
ctgccggcacagaaggtctgcctgcgctgcgaggctccctgctgccagtctcacgtgcag
acgcacctgcagcagccctccaccgcccgcgggcacctcctggtggaggcggacgacgtg
cgggcctggagctgcccgcagcacaacgcctaccgcctgtaccactgcgaggccgagcag
gtggcggtgtgccagtactgctgctactacagcggcgcgcatcagggacactcggtgtgt
gacgtggagatacggaggaatgagatacggaagatgctaatgaagcagcaggagcgactg
gaggagagagagcaggacattgaggaccagttgtacaagcttgagtcagacaagcgcctg
gtggaggagaaagtgagccaactgaaggaggaagtgaggctgcagtatgaaaagctgcac
cagctgctggacgaggacctgcggcagacagtggaggtcctagacaaggcgcaggccaag
ttctgcagcgagaacgcggcgcaggcgctgcacctcggggagcgcatgcaagaggctaag
aagctgctgggctccctgcagctcctctttgacaagacagaggacgtcagcttcatgaag
aataccaagtctgtgaaaatcctaatggacaggacccagacctgcacaggcagcagcctt
tctccccctaagatcggccacctgaactccaagctcttcctgaacgaggtggccaagaag
gagaagcagttgcggaagatgctagaaggtcccttcagcacgccggtgcccttcctacag
agcgtccccctgtacccttgtggtgtgaacagctctggggcagagaagcgtaagcactcc
acggccttcccagaggctagcttcctggagacttcatcaggcccggtgggcagccagtac
ggggcagcaggcccagccagcagcgaggggcagtccgggcaacccctggggccctgtagc
tccacgcagcacttggttgctttgccaggtggtgcccagccagtacactcgagtcctgtg
tttcccccatcacagtaccccaatggctctgccactcagcagcccatgctaccccagtat
ggcggtcgcaagattctcgtctgttctgtggacaactgttattgttcttccgtggccaac
catggtggccaccagccgtacccccgatccggccacttcccctggacagtgccctctcaa
gaatactcacacccacttccacccacaccctccgtccctcagtccctctctggcctggca
gtcagagactggctcgacgcttcccagcagcctggccaccaagatttctacagggtgtat
gggcagccatccaccaaacactatgtgacaagctaa

DBGET integrated database retrieval system