KEGG   Rattus norvegicus (rat): 689890
Entry
689890            CDS       T01003                                 

Gene name
Srsf1, Sfrs1
Definition
(RefSeq) serine and arginine rich splicing factor 1
  KO
K12890  splicing factor, arginine/serine-rich 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno04657  IL-17 signaling pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    689890 (Srsf1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    689890 (Srsf1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    689890 (Srsf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    689890 (Srsf1)
Spliceosome [BR:rno03041]
 Common components
  Common spliceosomal components
   SR proteins
    689890 (Srsf1)
SSDB
Motif
Pfam: RRM_1 RRM_occluded RRM_3 Nup35_RRM_2 DDE_Tnp_1 RRM_7 CoV_nucleocap PRP38_assoc
Other DBs
NCBI-GeneID: 689890
NCBI-ProteinID: NP_001103022
RGD: 1587490
Ensembl: ENSRNOG00000050323
UniProt: D4A9L2
Position
10q26
AA seq 248 aa
MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVE
FEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSE
NRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKF
RSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPR
HSRSRSRT
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtcaggaggtggtgtgattcgtggcccggcagggaacaacgactgccgcatctacgtg
ggtaacctacctccagacatccgaaccaaggacattgaggacgtgttttacaaatacggc
gctatccgcgacatcgacctgaagaaccgccgcgggggaccgcccttcgccttcgttgag
ttcgaggacccgcgagacgcggaagatgcggtgtacggtcgcgacggctacgattacgac
ggctaccgtctgcgggtagagtttccccgaagcggccgtgggaccggccgaggcggcggc
gggggtggaggcggcggagccccgagaggccgctatggcccgccatccaggcggtctgaa
aacagagtggttgtttctggactgcctccgagtggaagctggcaggacttaaaggatcac
atgcgtgaagcaggtgatgtatgttatgctgatgtttaccgagatggcactggtgtcgtg
gagtttgtacggaaagaagatatgacgtatgcagttcgaaaactggataacactaagttt
agatctcatgagggagaaactgcctacatccgggttaaagttgatgggcccagaagtcca
agttatggaagatctcgatctcgaagccgtagtcgtagcagaagccgtagcagaagcaac
agcaggagtcgcagttactccccaaggagaagcagaggatcaccacgctattctccccgt
catagcagatctcgctctcgtacataa

DBGET integrated database retrieval system