KEGG   Rattus norvegicus (rat): 690516Help
Entry
690516            CDS       T01003                                 

Gene name
Smurf1, RGD1309707
Definition
(RefSeq) SMAD specific E3 ubiquitin protein ligase 1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04144  Endocytosis
rno04340  Hedgehog signaling pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    690516 (Smurf1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    690516 (Smurf1)
   04350 TGF-beta signaling pathway
    690516 (Smurf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    690516 (Smurf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    690516 (Smurf1)
   04121 Ubiquitin system [BR:rno04121]
    690516 (Smurf1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    690516 (Smurf1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     690516 (Smurf1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    690516 (Smurf1)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    690516 (Smurf1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  HECT type E3
   690516 (Smurf1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    690516 (Smurf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT WW C2 HPS3_N
Motif
Other DBs
NCBI-GeneID: 690516
NCBI-ProteinID: NP_001103068
RGD: 1594738
Ensembl: ENSRNOG00000000999
Vega: OTTRNOG00000000697
UniProt: D3ZCF5
Position
12p11
AA seq 728 aa AA seqDB search
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDP
KWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCK
LNPSDTDAVRGQIVVSLQTRDRIGGGGSVVDCRGLLENEGTVYEDSGPGRPLSCLMEEPA
PYTDGTGAAAGGGNCRFVESPSQDQRLLVQRLRNPEVRGSLQTPQNRPHGHQSPELPEGY
EQRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVD
HNNRTTQFTDPRLHHIMNHQCQLKEPSQPLQLPSEGSVEDEELPAQRYERDLVQKLKVLR
HELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVARE
WLYLLCHEMLNPYYGLFQYSTDNIYTLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYI
NGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRIL
QHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQK
ELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVTGSTR
VPLQGFKALQGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVE
ETCGFAVE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaccccgggacccgtaggaacggctccagcatcaagatccgtctgacagtattg
tgtgccaagaaccttgcaaagaaagacttcttcagactccccgacccctttgccaagatt
gttgtggacggctctgggcagtgccactcaaccgacactgtgaaaaacaccctggaccca
aagtggaaccagcactatgacctgtacgttgggaaaaccgactcgataaccatcagtgtg
tggaaccacaagaagatccacaagaagcagggggctggcttcctgggctgcgtgcggctg
ctctccaatgccatcagcagattgaaagataccggctaccagcgtttggatctatgcaaa
ctaaatccctcagatactgatgcagttcgtggccaaatagtggtcagtttacagacccga
gacagaataggtggtggagggtcggtggtggactgcaggggactgctggagaacgaagga
acggtatatgaagactcaggccctggaaggccgctcagctgcctcatggaggaacctgcc
ccgtatacagatggcaccggtgcagcggcaggaggtgggaactgcaggtttgtggagtct
ccaagccaagatcagagactcctggtacagcgactccgaaatcctgaggttcgaggatcc
ctacagacaccgcagaatcgaccacatggccaccagtcaccggagctgcctgaaggctac
gagcaaaggacaacagtgcagggacaagtttactttttgcacacgcagactggagtcagc
acatggcacgaccccaggatccccagagaccttaacagtgtgaactgcgatgaacttggg
ccactgcctccaggctgggaagtcagaagcacagtgtcgggaagaatctattttgtagat
cacaataataggacaacccagtttacagacccacggcttcaccacatcatgaatcaccag
tgccaactcaaggagcccagccagccgctgcagttgcccagtgagggctccgtggaggac
gaggagcttcctgcccagagatatgagagagatttagtccagaagcttaaagttctcaga
catgagctctctcttcagcagccccaagctggtcattgtcgcatagaagtttccagagaa
gaaatatttgaggagtcatatcgccagatcatgaagatgcgaccaaaagacctgaagaag
cgcctgatggtgaagttccgaggggaggaaggcttggactatggtggggtggctcgggag
tggctgtatttgttgtgccatgaaatgttgaatccgtattatggactcttccagtattcc
acggacaatatttacacactgcaaatcaacccagattcttctatcaaccctgaccatctg
tcttacttccactttgtgggtcgcatcatgggtctggctgtgttccatggacactacata
aacgggggcttcacagttcctttctacaagcagctcctgggaaaacccatccagctgtcg
gatctggagtcagtggacccagaacttcacaagagcttggtgtggattctagagaatgac
atcacgccagtgctggatcacaccttctgcgtggagcacaatgcttttgggcggatcctt
cagcatgaactgaaacccaatggcagaaatgtgcctgtcactgaggagaacaagaaggag
tatgtgcggttgtatgtgaactggaggtttatgagaggaatcgaagcccagttcctagcg
cttcagaaagggtttaacgaactcattccccaacacttactgaagccctttgaccagaag
gaactagagctgataataggcggcctggataagatagacctgaatgactggaagtccaac
actcggctgaagcactgtgtggcagacagcaacatcgtcaggtggttctggcaggcggtg
gagaccttcgatgaggagaggagagccaggctcctgcagtttgtgacaggatccacacga
gttcctctccaaggcttcaaggctctgcaaggcgcggcagggccccggctcttcaccatc
cacctgattgacgccaacaccgacaacctgcccaaggcccacacctgctttaatcggatt
gacatcccaccctatgagtcctatgagaagctctatgagaagctgctgacagcggtagag
gagacctgtggctttgccgtggagtga

DBGET integrated database retrieval system