KEGG   Rattus norvegicus (rat): 690820
Entry
690820            CDS       T01003                                 

Gene name
Klf16
Definition
(RefSeq) Kruppel-like factor 16
  KO
K09208  krueppel-like factor 9/13/14/16
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    690820 (Klf16)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    690820 (Klf16)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC zf-C2H2_8 zf-C2H2_6 zf-Di19
Other DBs
NCBI-GeneID: 690820
NCBI-ProteinID: NP_001121076
RGD: 1305966
Ensembl: ENSRNOG00000033694
UniProt: B2GUY9
Position
7q11
AA seq 251 aa
MSAAVACVDYFAADVLMAISSGAVVHRGRPGPEGAGPAAGLDVRATRREATPPGTPGAPP
PPATAPGSGGATAAPHLLAASILADLRGGPGVATAANTAGGTSPVSSSSAASSPSSGRAP
GAAKSHRCPFPGCAKAYYKSSHLKSHLRTHTGERPFACDWPGCDKKFARSDELARHHRTH
TGEKRFPCPLCTKRFTRSDHLTKHARRHPGFRPELLRRPGARSASPSDSLPCSLAGSPTP
SPVPSPAPAGL
NT seq 756 nt   +upstreamnt  +downstreamnt
atgtcggcggccgtggcgtgtgtggattactttgccgccgacgtgctcatggccatctct
tcgggagccgtggtgcatcgcgggcgacccggccccgagggcgcgggccccgctgccggc
ctggatgtgcgcgccacgcgccgcgaggccacgccgccggggacccctggggcaccgcca
ccgccagccaccgctccggggtcgggaggcgccaccgctgcgccccacctgctggccgcc
agcatcctggccgatctgagaggcgggccgggagtcgccacagcagccaacaccgcgggg
ggcacctctccggtctcctcctcctcggccgcttcgtctccgtcttcgggccgcgccccc
ggcgcggccaagagccaccgctgtcccttcccaggctgcgccaaagcctattacaagtct
tcgcacctcaagtcacacctgcggactcacacaggtgagcggccctttgcctgtgattgg
cctggctgtgacaagaagttcgcccgttccgatgagctggcccgccaccaccggacgcac
acaggcgagaagcgcttcccctgtcccctgtgtaccaagcgcttcacccgcagcgaccac
ctgaccaagcacgcccggcggcatcctggcttccgcccggaactactgcgacgacctggt
gcccgcagcgcctcgcccagcgactcgctgccctgcagcttggctggcagccccacacct
agccctgtccccagcccagctccggccggcttgtag

DBGET integrated database retrieval system