KEGG   Rattus norvegicus (rat): 691468Help
Entry
691468            CDS       T01003                                 

Definition
(RefSeq) RGD1561277
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    691468
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    691468
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    691468
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_4 zf-C2H2_6 C1_4 zinc_ribbon_15 Zn-ribbon_8
Motif
Other DBs
NCBI-GeneID: 691468
NCBI-ProteinID: XP_006221057
RGD: 1561277
Ensembl: ENSRNOG00000051868
UniProt: A0A0G2JZA5
Position
10q22
AA seq 634 aa AA seqDB search
MSKGVKTMDMSEGLVSFEDVSVDFTWDEWQDLDEAQRKLYRDVMLETYSSLMSLNQCDPK
PELILKLEKEAGPWKEDNSPNQSVPDVKNVNGRNEVSHDSQKIRRCNLVIAKSSASAKRA
PAGKALNSSYCISDLAIKNGTSSGMSPGVLNVWESMLLPSKPSKMQAREGLDLPDVTRGF
PRLPEALSLHPNTEFEQQHFQYCRPSEASHVKPVWLQKTFPMRNPSSKLRDNSQQLEKLA
LPAKEGTRAQLPAFECQVCGKLFCKNSHLTQHFKMHKEKCYRGNNCGPILNIQSKLPTYQ
SLGVGEELYTRDEAGKYICQKSAKSIQQKIIGDGRIVCGKTVCSKLNFSVQQNPRKDEKS
HDFSGKPISKSNLHELTTPHRYERVHECSACGKAFNPTPHVYSHSGAHPAEKPYECEDCQ
QSKLVGHPPAHAQEKRYVCHVCGKAFYKRAHLHAHQRTHTGEKPYDCKECGKSFRLKSFL
VVHQRIHTGEKPFACDTCGKSFKQRTSLYTHIRIHTGEKPYECKECRKSFILKSYLTVHQ
RTHSGEKPYGCDICGKSFKQNSHLHAHKRTHTSEKPYECIVCGKSYKQSPSLYTHKKVHT
SEKPYECKQCRKSFSLKFHLTRHQRTHSGEKHYQ
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggcgttaagacaatggatatgtctgagggcttggtgtcatttgaggatgtg
tctgtggacttcacctgggacgagtggcaggacctggatgaagctcagaggaagctctac
agggacgtgatgctggagacctacagcagcctgatgtccttgaatcagtgtgatcccaaa
cctgagttgatcctgaagttggaaaaagaagctgggccgtggaaggaagacaattctcca
aaccagagcgtcccagatgtgaagaatgtgaatggccggaatgaggtcagccatgacagc
caaaagatacgcagatgcaacctggtaattgccaagagcagcgcatcagctaagagggct
ccagcaggaaaagccttgaatagctcgtactgcatttcagatctggccataaagaacggc
acatcttctggaatgagccctggggtccttaatgtatgggaaagtatgcttctccctagc
aagcccagtaagatgcaggctagagagggacttgatcttcctgatgtaaccagggggttc
cccagacttcctgaggctcttagtctacatcccaatactgaatttgaacaacagcatttt
cagtactgtaggcccagtgaagcttcccatgtgaagccagtgtggttacagaaaacattc
cctatgagaaatccctccagtaagttgagggacaacagccaacagttagagaagttagct
cttcctgccaaagagggaactcgggcacagctgccagcttttgaatgccaagtgtgtggg
aagttattctgtaaaaattcccatctcacacagcattttaaaatgcacaaagaaaaatgt
tatagaggtaataactgtgggccaatactcaatatacaatcaaagctcccaacatatcag
agcttgggtgtgggagaagagctctacacacgtgatgaggctgggaagtacatctgtcag
aaatcagcaaaaagcattcagcagaaaatcataggcgatggaaggattgtgtgtgggaag
accgtgtgctcaaaattaaatttcagcgttcagcagaaccctcgcaaggatgagaaatcc
catgatttctctggaaaaccaatcagtaagtcaaacctccatgagctgacgacacctcac
agatacgagagagtgcatgagtgtagtgcgtgtggcaaagcctttaatcccacaccacat
gtctactcacactcgggagctcacccggctgagaaaccctatgagtgtgaagactgccag
caatcgaagctcgtggggcacccgccagctcacgcgcaggagaaacgctatgtgtgtcat
gtgtgtggaaaagccttttacaagcgagcccacttacacgcacaccagaggacccacaca
ggtgagaagccatatgactgtaaagaatgtgggaaatccttcagactgaagtcgtttctt
gtcgtacatcagaggattcacacaggtgagaaaccctttgcgtgtgatacgtgtgggaaa
agcttcaagcagaggacgagtctctacacacacataagaatccacacgggtgagaagccc
tatgagtgtaaagagtgtaggaagtcattcattctcaagtcatacctcactgtgcaccag
agaactcactcgggcgagaagccctatgggtgtgacatatgtggaaaatcctttaagcaa
aattcccaccttcatgcacataagagaactcacacaagcgagaaaccctacgagtgtatt
gtatgtggcaaaagttacaagcagagtccgagcctctacacacataagaaagtccatacc
agtgagaaaccctatgagtgtaaacaatgtagaaagtcatttagtctgaaattccacctc
actagacaccagagaactcactctggtgagaaacactatcagtga

DBGET integrated database retrieval system