KEGG   Rattus norvegicus (rat): 78974
Entry
78974             CDS       T01003                                 

Gene name
Six3
Definition
(RefSeq) SIX homeobox 3
  KO
K19473  homeobox protein SIX3/6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    78974 (Six3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, SIM
    78974 (Six3)
SSDB
Motif
Pfam: SIX1_SD Homeodomain Homeobox_KN HTH_3 Homez Sporozoite_P67
Other DBs
NCBI-GeneID: 78974
NCBI-ProteinID: NP_076480
RGD: 620909
UniProt: Q9ET75
Position
6q12
AA seq 337 aa
MVFRSPLDLYSSHFLLPNFADSHHCSLLLASSGGGSGAGGGGGAGGGGGGGGGNRAGGGG
AGGAGGGGGGGGGGSRAPPEELSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSL
PVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQ
EAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSK
KRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAE
SPSTAASPTTSVSSLTERADTGTSILSVTSSDSECDV
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggtattccgctcccccctagacctctattcctcccacttcttgttgccaaacttcgcc
gattctcaccactgctccctacttctggcgagtagcggcggcgggagcggtgcgggcggc
ggcggcggcgcgggaggaggcggcggcggcggcggcgggaaccgtgcgggaggcggcggt
gctggcggagcaggcggcggcggcggcggcggcggcggcggctccagggcccccccggaa
gagttgtccatgttccagctgcccaccctcaacttctcgccggagcaggtggccagcgtc
tgcgagacgctggaggagacgggcgacatcgagcggctgggccgcttcctctggtcgctg
cccgtggcccctggggcgtgcgaggccatcaacaaacacgagtcgatcctgcgcgcgcgc
gccgtcgtcgccttccacaccggcaacttccgagacctgtaccacatcctggagaatcac
aagttcaccaaggagtctcacggcaagctgcaggccatgtggctcgaggcgcactaccag
gaggccgagaagctgcgcggccgccctctcggcccggtggacaagtaccgcgtgcgcaag
aagttccctctgccgcgcaccatctgggatggggagcagaagacccattgcttcaaggag
cggactcggagcctgctgcgggaatggtacctgcaggatccctaccccaaccccagcaag
aaacgagaactggcgcaggccaccggcctcacccccacacaagtaggcaactggtttaag
aaccggcgacagcgcgaccgcgcagcggcggccaagaacaggctccagcaccaggccatc
gggccgagcgggatgcgctcgctggccgagcccggctgccccacgcacggctcagcagag
tcaccgtccacggcagccagtccgaccaccagtgtgtccagcctgacggagcgcgcggac
actggcacttctatcctctcggtaacctccagcgactcggaatgtgatgtatga

DBGET integrated database retrieval system