KEGG   Rattus norvegicus (rat): 79113
Entry
79113             CDS       T01003                                 

Gene name
Fgr, p55-Fgr
Definition
(RefSeq) FGR proto-oncogene, Src family tyrosine kinase
  KO
K08891  tyrosine-protein kinase Fgr [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    79113 (Fgr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    79113 (Fgr)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    79113 (Fgr)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     79113 (Fgr)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  SRC family
   79113 (Fgr)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    79113 (Fgr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 zf-RING_14 SH3_3
Other DBs
NCBI-GeneID: 79113
NCBI-ProteinID: NP_077059
RGD: 621319
Ensembl: ENSRNOG00000009912
UniProt: Q6P6U0
Position
5q36
AA seq 517 aa
MGCVFCKKLEPAPKEDVGLEGDFRSQGAEERYYPDPTQGRSSSISPQPISPAFLNVGNIR
SVSGTGVTIFVALYDYEARTGDDLTFTKGEKFHILNNTEYDWWEARSLSSGRTGYVPSNY
VAPVDSIQAEEWYFGKISRKDAERQLLSDGNPQGAFLIRESETTKGAYSLSIRDWDQNRG
DHIKHYKIRKLDMGGYYITTRAQFESVQDLVRHYMEVNDGLCYLLTAPCMVMKPQTLGLA
KDAWEIDRNSIALDRRLGTGCFGDVWLGTWNCSTKVAVKTLKPGTMSPKAFLEEAQIMKL
LRHDKLVQLYAVVSEEPIYIVTEFMCYGSLLDFLKDRKGHNLMLPNLVDMAAQVAEGMAY
MERMNYIHRDLRAANILVGEHLICKIADFGLARLIVDDEYNPQQGTKFPIKWTAPEAALF
GRFTVKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVEHGYHMPCPPGCPVSLYEVME
QTWRLDPEERPTFEYLQSFLEDYFTSTEPQYQPGDQT
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgggctgtgtgttctgcaagaagttagagcctgcacccaaggaggatgttggcctggaa
ggggacttccggagccaaggcgctgaagaacgctattaccctgaccctactcaaggccgg
tcttcgtccatctcgcctcagcccatcagccctgctttccttaatgttggcaacataaga
agcgtctctgggacgggagtgaccatattcgtcgccctgtatgactatgaggccaggaca
ggggatgacctcaccttcaccaaaggcgagaagttccacatcctgaacaatacggagtat
gactggtgggaggctaggtccctgagctccggacgcacgggctatgttcccagcaactat
gtggctcccgtggattccatccaggctgaagagtggtacttcggaaagatcagcagaaag
gatgcagagaggcagcttctctccgatggcaaccctcaaggggcctttctcattcgggaa
agcgagaccaccaaaggtgcctactccctgtccatccgtgactgggaccagaacagaggc
gaccacataaagcattacaagatccgaaagctggacatgggtggctactacatcaccacg
cgggcccagttcgaatccgtgcaggacctggtgcggcactacatggaagtgaatgacggt
ctatgctacttgctcaccgcaccctgtatggtcatgaagccccagactctaggcctggct
aaggatgcctgggagatcgaccgtaactccatagcacttgaccgcaggctgggcaccggc
tgctttggagacgtgtggctgggcacgtggaactgtagcacaaaggtggcagtgaaaacg
ctgaagccaggcaccatgtcgccgaaggccttcctggaggaggcacagatcatgaaactg
ctgaggcacgacaagctggtgcagctgtacgcggtggtgtcagaggaacccatttatatt
gtgacagagttcatgtgctatggtagcttgctggatttcctaaaggatcgaaagggtcac
aacttgatgctgcccaatctagtggacatggctgcccaggtagcagagggcatggcctac
atggagcgcatgaactatatccaccgagacctgagagcagccaacatcctggtgggggaa
catctaatatgcaagatcgctgactttgggttggcacgcctcatagtggacgatgagtac
aacccccaacaaggaaccaagtttcccatcaagtggacagccccagaggctgctctcttt
ggcagattcactgtcaaatcagacgtgtggtcctttgggattctgctcactgaactgatc
accaagggcagagttccatacccaggtatgaacaaccgggaagtgttggaacaggtagag
cacggctaccacatgccatgccctccgggatgcccagtatccctgtatgaggtcatggag
cagacctggcgtctggatccagaggagaggcccacctttgagtacctgcagtctttcctg
gaagactatttcacctccacagaaccacagtatcagcccggagaccagacatag

DBGET integrated database retrieval system