KEGG   Rattus norvegicus (rat): 79129
Entry
79129             CDS       T01003                                 

Gene name
Cyba
Definition
(RefSeq) cytochrome b-245 light chain
  KO
K08009  cytochrome b-245, alpha polypeptide
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04380  Osteoclast differentiation
rno04613  Neutrophil extracellular trap formation
rno04621  NOD-like receptor signaling pathway
rno04670  Leukocyte transendothelial migration
rno05020  Prion disease
rno05140  Leishmaniasis
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    79129 (Cyba)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    79129 (Cyba)
   04621 NOD-like receptor signaling pathway
    79129 (Cyba)
   04670 Leukocyte transendothelial migration
    79129 (Cyba)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    79129 (Cyba)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    79129 (Cyba)
  09164 Neurodegenerative disease
   05020 Prion disease
    79129 (Cyba)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    79129 (Cyba)
   05418 Fluid shear stress and atherosclerosis
    79129 (Cyba)
   05415 Diabetic cardiomyopathy
    79129 (Cyba)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    79129 (Cyba)
Membrane trafficking [BR:rno04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    79129 (Cyba)
SSDB
Motif
Pfam: Cytochrom_B558a Cg6151-P DUF6030
Other DBs
NCBI-GeneID: 79129
NCBI-ProteinID: NP_077074
RGD: 620573
Ensembl: ENSRNOG00000013014
UniProt: Q62737
Position
19
AA seq 192 aa
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVLICLLEYPRGKRK
KGSTMERCGQKYLTAVVKLFGPLTRNYYVRAVLHLLLSVPAGFLLATILGTVCLAIASVI
YLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEAEEEAASAGGP
QVNPIPVTDEVV
NT seq 579 nt   +upstreamnt  +downstreamnt
atggggcagatcgagtgggccatgtgggccaacgaacaggcgctggcatctggcctgatc
ctcatcacagggggcatcgtggctactgcgggacgcttcacgcagtggtactttggtgct
tactctattgttgcaggagtgctcatctgtctgctggagtacccccggggaaagaggaaa
aagggctccaccatggagcggtgtggacagaagtacctgaccgctgtggtgaagctgttc
gggcccctcaccagaaattactacgtccgggctgtcctccacttactgctgtccgtgcct
gcaggcttcctgctggccaccatcctggggaccgtctgcttggccattgccagtgtgatc
tacctgctggcagccatccggggtgagcagtggactcccattgagcctaaacccaaggag
cggccgcaggttggaggcaccatcaagcagccacctaccaaccccccaccccggccacca
gcggaggtccgcaagaagccaagtgaggccgaagaggaggcagcctcggcaggaggaccc
caggttaacccaattccagtgacagatgaggtcgtgtga

DBGET integrated database retrieval system