KEGG   Rattus norvegicus (rat): 79249
Entry
79249             CDS       T01003                                 

Gene name
Abi1, E3b1
Definition
(RefSeq) abl-interactor 1
  KO
K23649  abl interactor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    79249 (Abi1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    79249 (Abi1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   79249 (Abi1)
SSDB
Motif
Pfam: Abi_HHR SH3_1 SH3_9 SH3_2 ATP-synt_ab_Xtn GP3_package
Other DBs
NCBI-GeneID: 79249
NCBI-ProteinID: NP_077373
RGD: 621008
Ensembl: ENSRNOG00000031325
UniProt: A2VD09
Position
17q12.3
AA seq 481 aa
MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLAS
VAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR
THKIIAPANMERPVRYIRKPIDYTVLDDVGHGVKWLKAKHGNNQPARTGTLSRTNPPTQK
PPSPPVSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHS
GSSGGSGSRENSGSSSIGIPIAVPTPSPPTAGPAAPGAAPGSQYGTMTRQISRHNSTTSS
TSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSISIAPPPPPMPQLTPQIPLTGFVARVQE
NIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVDYEDEEAAVVQYSDPYADGDPAWAPKNY
IEKVVAIYDYTKDKDDELSFKEGAIIYVIKKNDDGWFEGVCNRVTGLFPGNYVESIMHYT
D
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggcagagctgcagatgttactagaggaggagatcccgtctggcaagagggcgctgata
gagagttaccagaacctgacccgggtggcggactactgtgaaaacaactacatacaggct
acagacaagaggaaagctctagaagagaccaaagcatatacaactcaatctctagctagt
gttgcttatcaaataaatgcattggccaacaatgtgctccagctgctggatatccaggcc
tctcagctgcggaggatggagtcgtccatcaatcacatctcacagactgtggatattcat
aaagaaaaagtggctcgaagagagattggtattttgacaacaaataagaatacatcaaga
actcataaaataatcgcacctgcaaatatggagcgtcctgtcaggtatattcggaaacct
attgactacacagttctggatgatgtgggccatggagttaagtggctaaaagccaagcac
ggaaataaccagcctgcaagaactggcacattgtcgagaacaaatcctcccacgcagaaa
ccaccaagccctcctgtgtcaggccgaggaactttggggcggaataccccttacaaaacc
ctagagcctgttaagcctcccacagttcctaatgactacatgactagtcctgcgaggctt
ggaagccagcatagtccaggcaggacggcttctttaaatcagagaccaaggacgcatagt
gggagtagtggaggaagcggaagccgggaaaacagtgggagcagcagcattggtattccc
attgctgtgcccacaccctccccgcccactgcgggcccagcagcccctggcgcagctcct
ggttcccagtatggcacaatgaccaggcagatttctcgacacaactctaccacttcttcg
acatcttctggtggatatagacgaactccctctgtgactgcgcaattctctgctcagcct
catgttaatggaggtccactttattctcaaaattcaatttctattgccccccctcctccc
cccatgcctcagttgactccacagatacctctcacaggcttcgtggccagggtgcaggaa
aacattgctgatagcccaactccaccaccacctcctccaccagatgacattcccatgttc
gatgactctccacctcccccaccacctcctcctgtggactacgaagacgaagaagctgca
gtagttcagtatagtgacccatatgcagatggggaccctgcatgggctcccaagaactat
attgagaaagttgttgcaatatatgattatacaaaagacaaggatgatgagctgtccttt
aaagagggtgcaatcatctatgtcataaagaagaacgatgatggctggttcgaaggagtt
tgcaatcgagtaactggactcttccctgggaactatgttgaatcaatcatgcactatact
gattag

DBGET integrated database retrieval system