KEGG   Rattus norvegicus (rat): 79435Help
Entry
79435             CDS       T01003                                 

Gene name
Ube2d4, RGD69425, Ube2d2, Ube2d2b
Definition
(RefSeq) ubiquitin-conjugating enzyme E2D 4 (putative)
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    79435 (Ube2d4)
   04120 Ubiquitin mediated proteolysis
    79435 (Ube2d4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    79435 (Ube2d4)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     79435 (Ube2d4)
Ubiquitin system [BR:rno04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   79435 (Ube2d4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Motif
Other DBs
NCBI-GeneID: 79435
NCBI-ProteinID: NP_112263
RGD: 69425
Ensembl: ENSRNOG00000034016
UniProt: P70711
Position
14p22
AA seq 147 aa AA seqDB search
MALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEY
PFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLLCDPNPDDPLV
PEIAQIYKTDRDKYNRTAREWTQKYAM
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaagagaatccacaaggaactgaacgacctggcgcaggatcccccagcacag
tgttcagcaggtcctgtcggggaagatatgttccattggcaagctacaatcatggggcca
aatgacagtccctaccagggtggagcatttttcttgacaattgatttcccaacagagtac
cccttcaaaccacctaaggttgaatttacaacaagaatttatcatccaaatgttaacagt
aatggcagcatttgtcttgatattcttcggtcacagtggtctccagcactaactatttca
aaagtacttttgtccatcagttctctgttgtgtgatcccaatcccgatgatcccttagtg
cctgagattgctcagatctacaaaacagatagagacaagtacaacagaacagctcgggaa
tggactcagaagtatgccatgtga

DBGET integrated database retrieval system