KEGG   Rattus norvegicus (rat): 80278
Entry
80278             CDS       T01003                                 

Gene name
Cdk5rap3, C53
Definition
(RefSeq) CDK5 regulatory subunit associated protein 3
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF773 DUF3502
Other DBs
NCBI-GeneID: 80278
NCBI-ProteinID: NP_077814
RGD: 620002
Ensembl: ENSRNOG00000048747
UniProt: Q642E3
Position
10q31
AA seq 504 aa
MQDHQHVPIDIQTSKLLDWLVDRRHCNLKWQSLVLTIREKINTAIQDMPESQEIAQLLSG
SYIHYFHCLRIVDLLKGTEASTKNIFGRYSSQRMKDWQEIISLYEKDNTYLVELSSLLVR
NVNYEIPSLKKQIAKCQQLQQDYSRKEEEGQAGAAEMREQFYHSCKQYGITGDNVRRELL
ALVKDLPSQLAEIGAGAQSLGEAIDLYQACVEFVCDSPTEQVLPMLRYVQKKGNSTVYEW
RTGTEPSVVERPQLEDPPEQVQEDEIDWGDFGLEAVSDSGNIISAETPGIDWGISLESES
KDAGADKIDWGDNAVASEITVLETGTEAPEGVARGSDALTLLEYPETRNQFIDELMELEI
FLSQRAVEMSEEADILSVSQFQLAPAILQGQTKEKMLSLVSTLQHLIGQLTSLRMQHLFM
ILASPRYVDRVTELLQQKLKQSQLLALKKDLMVEKQQEALQEQAALEPKLDLLLEKTREL
QKLIEADISKRYNGRPVNLMGTSV
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgcaggaccatcagcacgtgcccatcgacatccagaccagcaagctgctcgattggctg
gtggacagaagacactgcaacttaaaatggcaaagcctggtgctgaccatccgggaaaag
atcaacaccgccatccaggacatgccagagagccaagagattgcccagctgctctctggt
tcctacatccactacttccactgcctaagaatagtggaccttcttaaaggtaccgaggct
tccaccaaaaatatttttggccgctactcttcacagcggatgaaggattggcaggagatc
ataagcctgtatgagaaggacaacacctatttagtggaactctctagcctcctggttcgg
aatgtcaactatgagatcccctctctgaagaagcagattgccaagtgccagcaactgcag
caagactacagccgcaaggaggaggagggccaggctggggctgctgagatgcgagagcag
ttctaccactcctgcaaacagtacggcatcacgggagacaatgtccgacgagagcttctg
gccctggtgaaggacctgccaagtcagctggctgagataggagcgggagctcagtccctg
ggggaagccatcgacctgtaccaggcctgtgtggagtttgtatgtgacagccccacagag
caggtgctgcccatgctgcggtacgttcagaagaagggaaactccacggtgtatgagtgg
aggacagggacagagccctctgtggtagagcggccacaactggaggaccctcccgagcag
gtgcaagaagacgagatcgactggggcgactttggcctggaggctgtttctgactctgga
aacatcatctctgctgagacccctgggatagactggggtatctccctggagtcagagtcc
aaggatgctggggctgacaagatagactggggtgacaatgctgttgcttcggagatcacc
gtgctggagacaggaacggaggctccagagggtgttgctaggggctcagacgctctgact
ctccttgaataccctgagactcggaatcagttcatcgatgagctcatggagcttgagatc
ttcttgtctcagagagcagtagagatgagtgaggaggctgacatcctgtccgtgagccag
ttccagctggctcctgccatccttcagggccagaccaaggagaagatgctcagcctggtg
tccacactgcagcatctgattggccagctcaccagtctccggatgcagcacctgtttatg
attctggcctcaccgaggtatgtggaccgggtgacagagctcctccagcagaagctgaag
cagtcccagctgttggctctgaagaaggacctgatggtggagaagcagcaggaggcgctt
caggagcaggcagcgctggagcccaagctggacctgctgctggagaagaccagagagctg
cagaagctgattgaagctgacatctccaagagatacaacggccgtcctgtgaacctgatg
gggacctctgtgtga

DBGET integrated database retrieval system