KEGG   Rattus norvegicus (rat): 81510Help
Entry
81510             CDS       T01003                                 

Gene name
Mia, Cdrap, Mia1
Definition
(RefSeq) melanoma inhibitory activity
  KO
K16655  melanoma inhibitory activity protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    81510 (Mia)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_2 SH3_9 SH3_1
Motif
Other DBs
NCBI-GeneID: 81510
NCBI-ProteinID: NP_110479
RGD: 620883
Ensembl: ENSRNOG00000001499
UniProt: Q62946
Position
1q21
AA seq 130 aa AA seqDB search
MVCSPVLLGIVILSVFSGLSRADRAMPKLADRKLCADEECSHPISMAVALQDYVAPDCRF
LTIYRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAAHLGYFPSSIVREDLTLKPGKVDM
KTDEWDFYCQ
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgctccccagtgctccttggtattgtcatcttgtctgttttttcaggcctcagc
agggctgatcgagccatgcccaagctggctgaccggaagctgtgtgcagatgaggagtgt
agccatcctatctccatggctgtggcccttcaggactacgtggcccctgattgccgcttc
ttgactatatacaggggccaagtggtatatgtcttctccaagttgaaaggccgtggacgg
cttttctggggaggcagtgtgcagggagattactatggagacctggcagcccacctgggc
tatttccccagtagcattgtccgggaggacctgactctgaaacctggcaaagtcgatatg
aagacagatgaatgggatttctactgtcaatga

DBGET integrated database retrieval system