KEGG   Rattus norvegicus (rat): 81514
Entry
81514             CDS       T01003                                 

Gene name
Lrrn3, Nlrr3
Definition
(RefSeq) leucine rich repeat neuronal 3
  KO
K24492  leucine-rich repeat neuronal protein 1/2/3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    81514 (Lrrn3)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   81514 (Lrrn3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Ig_3 I-set LRR_9 fn3 LRRNT Ig_2 ig LRRCT Pur_ac_phosph_N PTP_tm
Other DBs
NCBI-GeneID: 81514
NCBI-ProteinID: NP_110483
RGD: 71066
Ensembl: ENSRNOG00000006368
UniProt: Q9ESY6
Position
6q21
AA seq 707 aa
MKDAPLQIHVLLGLAITALVQAGDKKVDCPQLCTCEIRPWFTPRSIYMEASTVDCNDLGL
LNFPARLPADTQILLLQTNNIARIEHSTDFPVNLTGLDLSQNNLSSVTNINVQKMSQLLS
VYLEENKLTELPEKCLYGLSNLQELYVNHNLLSAISPGAFVGLHNLLRLHLNSNRLQMIN
SKWFEALPNLEILMLGDNPILRIKDMNFQPLLKLRSLVIAGINLTEVPDDALVGLENLES
ISFYDNRLNKVPQVALQKAVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELVSI
DSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYHGTIESLPNL
KEISIHSNPIRCDCVIRWINMNKTNIRFMEPDSLFCVDPPEFQGQNVRQVHFRDMMEICL
PLIAPESFPSILDVEADSYVSLHCRATAEPQPEIYWITPSGKRLLPNTLREKFYVHSEGT
LDIRGITPKEGGLYTCIATNLVGADLKSIMIKVGGFVPQDNNGSLNIKIRDIRANSVLVS
WKANSKILKSSVKWTAFVKTEDSQAAQSARIPSDVKVYNLTHLKPSTEYKICIDIPTIYQ
KSRKQCVNVTTKSLEHDGKENGKSHTVFVACVGGLLGIIGVMCLFGCVSQEGNCENEHSY
TVNHCHKPTLAFSELYPPLINLWESSKEKPASLEVKATAIGVPTSMS
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgaaggacgcaccactccaaatccacgtgctacttggcctggctatcaccgcactcgta
caagccggagataaaaaagtggattgcccccagttatgtacatgtgagatcaggccttgg
ttcactcccagatccatctatatggaagcatcgacagtggactgtaatgatttagggctt
ttaaacttcccggccagattgcctgcagacacacagattttgctcctgcagactaacaat
attgcaagaattgaacattccacagactttccagtaaaccttactggcctggacttatct
cagaacaatttatcttcggtcactaatattaatgtacaaaagatgtcccagcttctttct
gtatacctagaggaaaacaagctaacggagctgcctgaaaagtgtctgtatggactgagt
aacttgcaggagctttacgtcaatcacaacttgctgtctgccatctctcccggagccttc
gttggcctacataaccttcttcgacttcatctcaactcaaacagactgcagatgatcaac
agtaagtggtttgaggctcttcctaatcttgagattctgatgctcggggacaaccccatc
ctcagaatcaaggacatgaactttcagcctcttctcaagctccgcagcctggttatcgct
ggcataaacctcacagaagtaccagatgatgccttggttggactggaaaacctggaaagc
atctctttttatgataataggcttaataaggtaccccaggttgctcttcaaaaggctgtc
aacctcaagtttttggatctaaataaaaaccctattaacagaatacgaaggggtgatttt
agcaatatgctacacttgaaggagttggggataaacaatatgcctgaacttgtctccatt
gacagtctcgctgtggataacttgccagatttgagaaaaatagaagctactaacaacccc
aggttgtcttacattcaccctaatgcatttttcagactcccaaagctagaatctctcatg
ctgaacagcaatgccctcagtgccctctaccatggtaccatagagtctttgccaaacctc
aaggaaatcagcatacacagcaatcccatccggtgtgactgtgtaatccgctggattaac
atgaacaaaaccaacattcggtttatggaaccagattctctgttctgtgtggacccacct
gaattccaaggccagaatgttcgacaagtgcatttcagggatatgatggaaatctgcctc
cctcttatagctcctgagagctttccttccatcctggatgtagaagctgacagctatgtg
tcgcttcactgcagagccactgcagaaccccagcctgaaatctactggatcacaccttct
ggtaaaagactattgccaaacactctgagagagaagttctatgttcattctgaaggcaca
ctagacataagaggcataaccccaaaggaaggtgggttgtacacctgcatagctactaac
ctagtcggtgctgacttgaagtctattatgatcaaagtgggaggttttgttcctcaggat
aacaacgggtcattgaatattaaaataagagatatccgggccaattctgttctggtgtct
tggaaagcaaactctaaaattctcaaatccagtgttaagtggacagcctttgttaagact
gaagactcccaggctgcccaaagtgctcgaataccatctgatgtcaaggtatacaatctt
actcatctgaaaccttctactgagtacaaaatttgtattgatattcccaccatctatcag
aaaagcagaaaacaatgtgtgaatgtgaccacgaaaagtctggagcatgacggaaaagaa
aatggaaagagtcacacagtatttgtggcctgcgttggaggtcttctggggatcattggt
gtaatgtgtcttttcggctgtgtctcacaagaagggaactgtgagaatgaacacagctat
actgtgaaccactgtcacaagccaaccttggcattcagtgagctttaccctcctctaatc
aacctctgggagtccagcaaagaaaaaccggcatcgttggaagtaaaagcaactgctata
ggtgtgccgacaagtatgtcctaa

DBGET integrated database retrieval system