KEGG   Rattus norvegicus (rat): 81527
Entry
81527             CDS       T01003                                 

Gene name
Nrp2
Definition
(RefSeq) neuropilin 2
  KO
K06819  neuropilin 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81527 (Nrp2)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Others
    81527 (Nrp2)
SSDB
Motif
Pfam: CUB F5_F8_type_C DUF3481 MAM
Other DBs
NCBI-GeneID: 81527
NCBI-ProteinID: NP_110496
RGD: 621442
Ensembl: ENSRNOG00000031232
UniProt: O35276
Position
9q32
AA seq 925 aa
MDMFPLTWIFLALYFSGHKVRSQQDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWVVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSVL
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPRMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSKLRS
STGILSLTFHTDMAVAKDGFSARYYLVHQEPPENFQCNAPLGMESGRIANEQISASSTFS
DGRWTPQQSRLHGDDNGWTPNVDSNKEYLQVDLRFLTMLTAIATQGAISRETQKGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDATELVLNKLHTPLLTRFIRIRPQTWHLGIAL
RLELFGCRVTDAPCSNMLGMLSGLIADTQISASSTREYLWSPSAARLVSSRSGWFPRNPQ
AQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAMEARAFVRKFKVSYSLNGKDWEYIQD
PRTQQPKLFEGNMHYDTPDIRRFEPVPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPMDEDATECGENCSFEDDKDLQLPSGFNCNFDFPEETCGWMYD
RAKWLQSTWISSANPNDRTFPDDKNFLKLQSDGGREGQFGRLISPPVHLPRSPVCMEFQY
QAMGGHGVALQVVREARQESKLLWVIREDQGSEWKHGRIILPSYDMEYQIVFEGVIGKGR
SGEISIDDIRISTDVPLENCMEPISAFAVDIPEIHGGEGYEDEIDDDYEGDWNNSSSTSG
AGSPSSGKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTLE
NYNFELYDGLKHKVKINHQKCCSEA
NT seq 2778 nt   +upstreamnt  +downstreamnt
atggatatgtttcctctcacctggattttcttagctctgtacttttcgggacacaaagtg
agaagccagcaagatccgccctgcggaggtcggctgaattccaaagatgctggctatatc
acttccccaggttacccccaggactatccctctcaccagaactgtgagtgggttgtctat
gcccccgaacccaaccagaagattgtcctcaacttcaaccctcactttgaaatcgagaag
catgactgcaagtatgacttcattgagattcgggatggagacagtgagtcagctgacctc
ctgggcaagcactgtgggaacattgcccctcccaccatcatctcttccggctccgtgtta
tatatcaagttcacatcagactacgcccggcagggggcaggtttctccctacgctatgag
atcttcaaaacaggctctgaagattgttccaagaactttacaagccccaatgggaccatt
gaatctccagggtttccagagaaatatccacacaatctggactgtaccttcaccatcctg
gccaaacccaggatggagatcatcctacagttcctgacctttgacctggagcatgaccct
ctacaagtgggggaaggagactgtaaatatgactggctggacatctgggatggcattcca
catgttgggcctctgattggcaagtactgtgggacgaaaacaccctccaaactccgctcg
tccacagggatcctctccctgacctttcacaccgacatggccgtggccaaggatggcttc
tcagcacgttactatttggtccaccaagaaccacctgagaactttcagtgcaatgcccct
ctgggaatggagtctggccggattgctaatgaacagatcagtgcctcatccaccttctct
gatgggaggtggactcctcaacagagcaggctccatggtgatgacaatggctggacaccc
aacgtggattccaacaaggagtatctccaggtggacctgcgcttcctaaccatgctcaca
gccattgcaacacaaggagccatttccagggagacccagaagggctactacgtcaaatcg
tacaagctggaagtcagcacaaacggggaagattggatggtctaccggcatggcaaaaac
cacaaggtattccaggctaacaatgatgccaccgagttggttctgaacaagctgcacacg
ccgctgttgactcgtttcatcaggatccgcccgcagacgtggcatttgggcatagccctt
cgactggagctctttggttgccgggtcacagatgcaccctgctccaacatgctgggaatg
ctctcgggcctcattgctgatacccagatctctgcctcctccacccgagagtacctctgg
agccccagtgctgcccgcctggttagcagccgctctggctggttccctcggaaccctcaa
gcccagccaggtgaagaatggcttcaggtggatcttgggacacccaagacggtgaaaggc
gtcatcatccagggggcccgaggaggagacagtatcactgccatggaagccagggcattt
gtacgcaagttcaaagtctcctacagcctaaatggcaaggactgggaatatatccaggac
cccaggactcagcagccaaagctgtttgaagggaacatgcactatgacacccccgacatc
cgaaggttcgagccagttccagcacagtacgtgcgggtatacccagagaggtggtcacca
gcgggcatcgggatgaggctggaggtcctgggctgtgactggacagactcaaagcccaca
gtggagacgctgggacccaccgtaaagagtgaagagaccaccaccccatatcccatggat
gaggatgccacggagtgtggggaaaactgcagctttgaggatgacaaagatttgcaactt
ccttcaggattcaactgcaactttgattttcctgaagagacctgtggttggatgtacgac
cgtgccaagtggctgcagagtacctggatcagcagtgccaaccctaacgacagaacgttt
ccagatgacaagaacttcctgaaactacagagcgacggcggacgagagggccagtttggg
cggctcatcagcccaccagtgcacctgccccgaagccctgtgtgcatggagttccaatac
caagccatgggcggccacggggtggcactgcaggtggttcgggaagccagacaggaaagc
aaactcctttgggtcatccgcgaggaccagggcagcgagtggaagcatggacgcattatc
ctgcccagctatgacatggagtatcagatcgtattcgagggagtgatcgggaaagggcga
tccggagagatttccatcgacgacattcggataagcaccgatgtcccactggagaactgc
atggaacccatctcggcttttgcagtggacatcccagaaatccatgggggagagggctat
gaagatgagattgatgatgactatgaaggagattggaacaactcttcctctacctcaggg
gctggtagtccctcatctggcaaagaaaagagctggctgtacacactggaccccatcctg
atcaccatcattgccatgagctcgctgggtgtcctgctgggggccacctgtgcgggcctc
ctcctctactgcacctgctcctactctggcctgagttcgagaagctgcaccacactggag
aactacaactttgagctctacgacggcctcaagcacaaggtcaagatcaatcaccagaag
tgctgctcggaggcatga

DBGET integrated database retrieval system